Recombinant Arabis hirsuta Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPLYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant Arabis hirsuta Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what role does it play in Arabis hirsuta?

Apocytochrome f is a protein encoded by the petA gene found in the chloroplast genome of Arabis hirsuta, a plant species belonging to the Brassicaceae family. This protein plays a crucial role in photosynthetic electron transport as a component of the cytochrome b6f complex, facilitating electron transfer between photosystem II and photosystem I. In Arabis hirsuta, as in other plants, the petA gene is highly conserved due to its essential function in primary metabolism . The protein is characterized as an "apocytochrome" before it acquires its heme group, at which point it becomes the functional cytochrome f.

How is the petA gene organized within the chloroplast genome of Arabis hirsuta?

The petA gene encoding Apocytochrome f in Arabis hirsuta is located within the large single-copy (LSC) region of the chloroplast genome. Based on comparative analysis with related species in the Brassicaceae family, the chloroplast genome typically contains a pair of inverted repeats (IRs) separating the LSC from a small single-copy (SSC) region. In the closely related Arabis stellari, the chloroplast genome is 153,683 bp with a 36.4% GC content, and similar organization is expected in A. hirsuta . The petA gene is part of the core set of conserved protein-coding genes found across most photosynthetic plants, maintained through strong selective pressure due to its essential function in photosynthesis.

How conserved is the petA gene across the Brassicaceae family?

The petA gene is highly conserved across the Brassicaceae family, showing minimal divergence compared to other protein-coding genes. Comparative genomic studies of the Brassicaceae family show that while genes like matK, ycf1, ccsA, accD, and rpl22 exhibit higher rates of divergence, the petA gene maintains high sequence identity across species . This conservation reflects the critical role of Apocytochrome f in photosynthesis, where mutations could significantly impact plant fitness. Minor variations in the sequence may occur, but the functional domains responsible for electron transport and protein-protein interactions remain largely invariant.

What structural modifications occur during post-translational processing of Arabis hirsuta Apocytochrome f?

Post-translational processing of Arabis hirsuta Apocytochrome f involves several critical modifications. After translation, the apocytochrome undergoes targeting to the thylakoid membrane via the chloroplast signal peptide, which is subsequently cleaved. The critical step involves covalent attachment of a heme group to create the functional cytochrome. This process requires specific enzymes including cytochrome c/f heme lyases that catalyze the stereospecific attachment of the heme to conserved cysteine residues. Additionally, proper folding is facilitated by chaperone proteins to ensure correct tertiary structure formation. For experimental studies, researchers should consider these modifications when designing expression systems, as bacterial systems may not reproduce all plant-specific post-translational modifications .

How can evolutionary selection pressure on the petA gene be quantified in Arabis hirsuta compared to other Brassicaceae species?

Evolutionary selection pressure on the petA gene can be quantified through several computational approaches. The primary method involves calculating the ratio of non-synonymous (KA) to synonymous (KS) nucleotide substitutions (KA/KS ratio). In related Arabis species, different genes show varying selection pressures. For example, the ndhA gene between A. stellari and A. hirsuta shows a KA/KS ratio of 1.35135, indicating positive selection . To analyze petA specifically:

  • Extract and align petA sequences from multiple Brassicaceae species, including A. hirsuta

  • Employ software like PAML, HyPhy, or MEGA to calculate site-specific and branch-specific KA/KS ratios

  • Identify specific codons under selection using likelihood ratio tests

  • Map these sites to the protein structure to determine functional implications of selection

What are the challenges in expressing functional recombinant Arabis hirsuta Apocytochrome f in heterologous systems?

Expressing functional recombinant Arabis hirsuta Apocytochrome f presents several significant challenges:

  • Codon optimization: Plant chloroplast genes often have codon usage preferences different from common expression hosts like E. coli, requiring codon optimization for efficient translation

  • Post-translational modifications: The proper attachment of the heme group requires specific enzymes that may be absent in heterologous systems

  • Membrane integration: As a membrane protein, Apocytochrome f requires proper insertion into membranes, which many expression systems struggle to accommodate

  • Protein folding: The protein may form inclusion bodies in bacterial systems due to improper folding

  • Chloroplast-specific chaperones: The absence of chloroplast-specific chaperones in heterologous systems may impair correct folding

Researchers have had greater success using specialized expression systems like cyanobacteria (which have similar photosynthetic machinery) or chloroplast transformation systems rather than standard E. coli expression systems .

What isolation and purification protocols yield the highest activity for recombinant Arabis hirsuta Apocytochrome f?

For optimal isolation and purification of recombinant Arabis hirsuta Apocytochrome f with high activity, the following protocol is recommended:

  • Expression system selection: Utilize either a cyanobacterial expression system (like Synechocystis) or a chloroplast transformation system that can properly process the protein and incorporate the heme group

  • Cell disruption: For plant material, use a buffer containing 50 mM Tris-HCl (pH 8.0), 10 mM EDTA, 2 mM β-mercaptoethanol, and protease inhibitors, followed by gentle disruption using glass beads or French press

  • Membrane fraction isolation: Perform differential centrifugation (10,000g followed by 100,000g) to isolate thylakoid membranes

  • Detergent solubilization: Solubilize membranes using mild detergents like n-dodecyl-β-D-maltoside (0.5-1%) or digitonin (1%)

  • Affinity chromatography: If using tagged recombinant protein, apply to appropriate affinity resin (His-tag or other fusion tags)

  • Size exclusion chromatography: Further purify using gel filtration to separate monomeric cytochrome f from aggregates

  • Activity preservation: Maintain the purified protein in a buffer containing 20 mM Tris-HCl (pH 7.5), 100 mM NaCl, 0.1% detergent, and 10% glycerol at -80°C for long-term storage

For activity assessment, spectroscopic measurements of the reduced and oxidized forms (monitoring absorbance at 552 nm) provide quantitative determination of functional protein yield .

How can researchers effectively analyze the interaction between Arabis hirsuta Apocytochrome f and other components of the photosynthetic electron transport chain?

Researchers can effectively analyze interactions between Arabis hirsuta Apocytochrome f and other photosynthetic electron transport components using these methodological approaches:

  • Biophysical interaction analysis:

    • Surface Plasmon Resonance (SPR) to measure binding kinetics with plastocyanin and other partners

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters of binding events

    • Fluorescence Resonance Energy Transfer (FRET) for monitoring interactions in near-native conditions

  • Structural studies:

    • Protein co-crystallization followed by X-ray crystallography

    • Cryo-electron microscopy of the entire cytochrome b6f complex

    • NMR spectroscopy for mapping interaction interfaces

  • Functional assays:

    • Reconstitution experiments in liposomes to measure electron transport rates

    • Oxygen evolution measurements in reconstituted systems

    • Flash photolysis to measure electron transfer kinetics

  • Cross-linking studies:

    • Chemical cross-linking coupled with mass spectrometry (XL-MS)

    • Site-directed cross-linking using genetically incorporated photo-activatable amino acids

  • Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics to study dynamic interactions

For each method, researchers should consider using both wild-type and strategically designed mutant versions of Apocytochrome f to map critical interaction residues and elucidate the structural basis for electron transfer .

What techniques are most effective for studying the structure-function relationship of Arabis hirsuta Apocytochrome f?

The most effective techniques for studying structure-function relationships of Arabis hirsuta Apocytochrome f include:

  • Site-directed mutagenesis:

    • Systematic mutation of conserved residues, particularly those involving heme coordination and predicted interaction sites

    • Creation of chimeric proteins with components from related species to identify domain-specific functions

  • Spectroscopic techniques:

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

    • Resonance Raman spectroscopy to analyze heme environment

    • EPR spectroscopy to characterize the electronic properties of the heme iron

  • Structural determination:

    • X-ray crystallography of the purified protein (resolution <2.5 Å preferred)

    • NMR spectroscopy for studying dynamic regions and solution behavior

    • Cryo-EM for structural analysis within the larger cytochrome b6f complex

  • Functional assays:

    • Electron transfer kinetics measurements using stopped-flow techniques

    • Redox potential determination via potentiometric titrations

    • Flash photolysis to measure electron transfer rates

  • Computational approaches:

    • Homology modeling based on related cytochrome f structures

    • Molecular dynamics simulations to analyze conformational changes

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for electron transfer pathways

A comprehensive approach would combine structural information with functional measurements of wild-type and mutant proteins to correlate specific structural features with functional properties .

How does the genetic structure of petA in Arabis hirsuta compare to other members of the Brassicaceae family?

The genetic structure of the petA gene in Arabis hirsuta shows high conservation when compared to other members of the Brassicaceae family, though with some distinctive features:

FeatureArabis hirsutaArabis stellariArabidopsis thalianaOther Brassicaceae
Gene length~1000 bp1002 bp1062 bp990-1080 bp
GC content~36-37%36.4%36.3%35-38%
Gene locationLSC regionLSC regionLSC regionLSC region
IntronsNoneNoneNoneNone
Promoter elementsConserved -10/-35Conserved -10/-35Conserved -10/-35Conserved -10/-35
Start codonATGATGATGATG
Stop codonTAATAATAATAA/TAG

The petA gene in all Brassicaceae lacks introns, facilitating its expression in the chloroplast. While the coding sequence shows high conservation (>90% identity), the highest variation occurs in the N-terminal region that encodes the transit peptide. Unlike some genes in the Arabis genus that show significant evolutionary changes (such as the absence of infA and rps16 genes noted in the Arabis genus), the petA gene remains structurally consistent, reflecting its essential function in photosynthesis .

What unique features of Arabis hirsuta Apocytochrome f might contribute to its adaptation to specific environmental conditions?

Arabis hirsuta Apocytochrome f may possess unique features that contribute to environmental adaptation, although these adaptations are subtle due to the protein's essential function. Potential adaptive features include:

  • Temperature stability adaptations: A. hirsuta, found in diverse habitats including rocky outcrops and mountain slopes, may have temperature-optimized variants of Apocytochrome f with amino acid substitutions that maintain protein stability across temperature fluctuations

  • Redox potential modifications: Minor variations in amino acids surrounding the heme group may fine-tune the redox potential to optimize electron transport under specific light conditions typical of A. hirsuta habitats

  • Interaction interface adaptations: The surface residues involved in interactions with plastocyanin or other electron transport components may show species-specific optimizations

  • Regulatory region variations: While the coding region is highly conserved, promoter and regulatory regions may contain variations that alter expression patterns in response to environmental stressors

  • Post-translational modification sites: Variations in phosphorylation, acetylation, or other modification sites may provide regulatory flexibility for environmental responses

These adaptations would be identified through comparative sequence analysis with other Brassicaceae species from different ecological niches, combined with structural modeling and functional assays under varying environmental conditions .

How do sequence variations in petA gene across Arabis species correlate with functional differences in photosynthetic efficiency?

Sequence variations in the petA gene across Arabis species can correlate with functional differences in photosynthetic efficiency through several mechanisms:

  • Redox potential tuning: Subtle amino acid changes near the heme-binding pocket can alter the midpoint potential of cytochrome f, affecting electron transfer rates and therefore photosynthetic efficiency. For instance, replacement of hydrophobic residues with charged ones can shift the redox potential by 5-20 mV.

  • Protein-protein interaction optimization: Variations in surface residues involved in interactions with plastocyanin can alter binding kinetics and electron transfer efficiency. These interactions are particularly important under limiting light conditions.

  • Thermal stability differences: Sequence variations that enhance thermal stability allow maintenance of photosynthetic function across broader temperature ranges. This is particularly relevant for Arabis species growing in alpine or variable temperature environments.

  • Post-translational regulation sites: Variations in sites for phosphorylation or other modifications may allow different regulatory responses to environmental cues like high light or drought.

To correlate sequence variations with functional differences, researchers should:

  • Perform comparative sequence analysis across multiple Arabis species

  • Map variations to structural models to identify functionally significant changes

  • Express variant proteins and measure electron transport kinetics

  • Correlate variations with habitat data and photosynthetic measurements from intact plants

Such studies would provide insight into how evolutionary pressures have fine-tuned this critical photosynthetic component across different ecological niches .

How can recombinant Arabis hirsuta Apocytochrome f be utilized in photosynthesis research?

Recombinant Arabis hirsuta Apocytochrome f offers several valuable applications in photosynthesis research:

  • Model system studies: As a component of the cytochrome b6f complex, recombinant Apocytochrome f provides a simplified system to study electron transport mechanisms without the complexity of whole thylakoid membranes

  • Structure-function analysis: The purified protein allows detailed investigation of how specific amino acid residues contribute to electron transfer through site-directed mutagenesis and functional assays

  • Interspecies comparative analysis: Comparing the properties of A. hirsuta Apocytochrome f with those from other species helps elucidate evolutionary adaptations in photosynthetic machinery

  • Photosynthetic efficiency studies: The protein can be incorporated into artificial membrane systems to study factors affecting electron transport rates and bottlenecks in the photosynthetic electron transport chain

  • Biosensor development: The redox-active properties of cytochrome f make it useful for developing biosensors for monitoring electron transport inhibitors or environmental toxicants

  • Educational tools: Purified, stable recombinant protein serves as an excellent teaching tool for laboratory courses on protein function and photosynthesis

  • Protein engineering platform: The well-characterized structure provides a scaffold for engineering modified electron transport proteins with altered properties for synthetic biology applications

For most effective application, researchers should ensure the recombinant protein contains properly incorporated heme and maintains native conformation .

What insights can comparative analysis of Arabis hirsuta petA gene provide for understanding chloroplast genome evolution?

Comparative analysis of the Arabis hirsuta petA gene offers valuable insights into chloroplast genome evolution:

  • Conservation patterns: The high degree of sequence conservation in petA across Brassicaceae highlights the strong purifying selection on photosynthetic machinery genes compared to other chloroplast genes that show greater divergence (like matK, ycf1, and accD)

  • Genome rearrangements: Analyzing the position of petA relative to other genes helps reconstruct evolutionary events like inversions and translocations that have shaped chloroplast genome architecture in the Brassicaceae family

  • Codon usage evolution: Comparative analysis of synonymous codon usage in petA across species reveals evolutionary pressures on translation efficiency within chloroplasts

  • RNA editing patterns: Differences in RNA editing sites in petA transcripts between species illuminate the evolution of this post-transcriptional regulatory mechanism

  • Selective pressure variations: The patterns of synonymous versus non-synonymous substitutions in different functional domains of petA reflect domain-specific selection pressures

  • Correlation with habitat adaptation: When correlated with species distribution and ecological data, sequence variations may reveal signatures of adaptation to specific environmental conditions

  • Horizontal gene transfer detection: Unusual sequence similarities with distant taxa could indicate rare horizontal gene transfer events involving chloroplast genes

This comparative approach should involve analysis of complete chloroplast genomes rather than isolated genes to provide context for understanding evolutionary patterns across the organellar genome .

How might genetic engineering of Arabis hirsuta Apocytochrome f contribute to improving photosynthetic efficiency in crop plants?

Genetic engineering of Arabis hirsuta Apocytochrome f could contribute to improving photosynthetic efficiency in crop plants through several innovative approaches:

  • Optimized electron transport kinetics: Engineering specific amino acid substitutions in cytochrome f to alter redox potential or protein-protein interaction efficiency could reduce bottlenecks in electron transport between photosystems

  • Enhanced stability under stress conditions: Introducing mutations that improve thermal stability or oxidative stress resistance based on adaptations found in A. hirsuta could maintain photosynthetic function under adverse conditions

  • Altered regulatory responses: Modifying sites for post-translational modifications could change how quickly the electron transport chain responds to fluctuating light conditions, potentially improving efficiency in field environments

  • Reduced photoinhibition: Engineering variants with altered interactions with other components could potentially reduce susceptibility to photoinhibition under high light

  • Chloroplast transformation approach: Using the petA gene from A. hirsuta as a selectable marker in chloroplast transformation constructs provides a tool for introducing other photosynthesis-enhancing modifications

For practical implementation, researchers would need to:

The most promising approach may involve combining cytochrome f modifications with other interventions targeting multiple steps in the photosynthetic process for synergistic improvements .

What are the critical quality control parameters for ensuring the biological activity of recombinant Arabis hirsuta Apocytochrome f?

Ensuring biological activity of recombinant Arabis hirsuta Apocytochrome f requires rigorous quality control parameters:

  • Spectroscopic integrity:

    • Absorption spectrum should show characteristic Soret band (~410 nm) and α/β bands (~550-560 nm)

    • Reduced minus oxidized difference spectrum should show expected peak-to-trough ratio

    • Pyridine hemochrome assay to confirm proper heme incorporation

  • Structural parameters:

    • Circular dichroism (CD) spectrum conforming to expected secondary structure composition

    • Thermal stability assessment (melting temperature) via differential scanning calorimetry

    • Size exclusion chromatography profile showing proper oligomeric state

  • Functional assays:

    • Redox potential determination (should be ~+330 mV at pH 7.0)

    • Electron transfer kinetics with physiological partners (plastocyanin)

    • Reconstitution assays measuring activity in artificial membrane systems

  • Biochemical purity:

    • SDS-PAGE showing >95% purity with expected molecular weight

    • Mass spectrometry confirmation of intact mass and peptide mapping

    • Absence of contaminating proteins, particularly other heme-containing proteins

  • Stability indicators:

    • Activity retention after freeze-thaw cycles

    • Long-term stability at different storage temperatures

    • Resistance to oxidative degradation

These parameters should be benchmarked against native cytochrome f isolated from plant material when possible, and detailed records maintained to ensure batch-to-batch consistency for experimental reproducibility .

How can researchers overcome challenges in crystallizing Arabis hirsuta Apocytochrome f for structural studies?

Crystallizing membrane proteins like Arabis hirsuta Apocytochrome f presents significant challenges. Researchers can employ these strategies to improve success:

  • Protein preparation optimization:

    • Engineer truncated constructs removing flexible regions while maintaining core structure

    • Consider fusion protein approaches (e.g., T4 lysozyme fusion) that provide crystal contacts

    • Test multiple expression systems to identify those producing the most homogeneous protein

    • Use size exclusion chromatography as final purification step to ensure monodispersity

  • Detergent screening:

    • Systematic screening of detergent types (maltoside, glucoside, and nonionic detergents)

    • Test detergent mixtures and novel amphipathic agents like peptergents

    • Employ detergent exchange during purification to identify optimal solubilization conditions

    • Consider bicelles or nanodiscs as alternatives to detergent micelles

  • Crystallization strategies:

    • High-throughput screening using sparse matrix and grid screens

    • Lipidic cubic phase (LCP) crystallization for membrane proteins

    • Counter diffusion techniques for generating gradual supersaturation

    • Microseeding to promote crystal growth from successful initial conditions

  • Additive approaches:

    • Screen with antibody fragments (Fab or nanobody) to provide crystal contacts

    • Test small molecule additives that promote crystal formation

    • Explore heavy atom derivatives early for phase determination

    • Consider natural binding partners for co-crystallization

  • Advanced techniques:

    • In situ diffraction screening to identify microcrystals

    • Serial crystallography at X-ray free-electron lasers for microcrystals

    • Cryo-EM as alternative approach if crystallization proves intractable

Success often requires iterative optimization, with each round of conditions informed by previous results .

What strategies can improve the expression yield of functional recombinant Arabis hirsuta Apocytochrome f?

To improve expression yield of functional recombinant Arabis hirsuta Apocytochrome f, researchers can implement these strategic approaches:

  • Expression system optimization:

    • Cyanobacterial systems: Synechocystis or Thermosynechococcus elongatus provide native-like environment for proper folding and heme incorporation

    • Chloroplast transformation: Tobacco or Chlamydomonas chloroplast transformation for homologous expression

    • Specialized E. coli strains: C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Cell-free systems: Chloroplast extract-based cell-free systems for rapid optimization

  • Genetic construct design:

    • Codon optimization: Adapt codon usage to expression host while maintaining rare codons at strategic positions

    • Fusion tags: N-terminal His10 tag with TEV protease cleavage site for purification

    • Signal sequences: Test various signal/transit peptides for optimal membrane targeting

    • Expression vector selection: Low-copy number vectors with tightly regulated promoters

  • Culture condition optimization:

    • Temperature reduction: Expression at 18-20°C to slow folding and improve proper membrane insertion

    • Induction protocol: Gradual induction using low inducer concentrations

    • Media supplementation: δ-aminolevulinic acid (heme precursor) and iron supplementation

    • Oxygen control: Microaerobic conditions may improve heme incorporation

  • Co-expression strategies:

    • Chaperones: Co-express with chloroplast-specific chaperones

    • Heme lyases: Co-express with cytochrome c/f heme lyases

    • Cytochrome maturation: Include complete cytochrome maturation (Ccm) system

  • Process scale optimization:

    • High-density cultivation: Fed-batch or continuous cultivation techniques

    • Induction timing: Optimize based on growth phase and cell density

    • Harvest timing: Determine optimal post-induction time for maximum yield

Implementation of these strategies typically requires systematic testing, with yields monitored both by total protein recovery and by functional assays measuring properly folded, heme-containing cytochrome f .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.