Recombinant Arabis hirsuta Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

The cemA gene encodes a chloroplast envelope membrane protein conserved across Brassicaceae species, including Arabis hirsuta, Arabis stellari, and Arabidopsis thaliana . Key attributes include:

PropertyDetail
Uniprot IDA4QK30 (Arabis hirsuta)
Protein Length229 amino acids (partial sequences reported in recombinant forms)
FunctionLikely involved in photosynthetic processes and membrane integrity
Sequence MotifsContains hydrophobic regions consistent with membrane localization

Amino Acid Sequence Highlight (Partial):
MAKKKAFIPFFYFTSIVFLPWLISLCCNKSLKIWITNWWNTRQCETFLNDIQEKSVLEKF IQLEDLFQLDEMIKEYPETDLQQFRLGIHKETIQFIKIHNEYHIHTILHFSTNLISFVIL SGYSFWGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND

Production Methods

Recombinant cemA is typically expressed in heterologous systems (e.g., baculovirus-infected insect cells or E. coli) with tags for purification. Key parameters include:

ParameterSpecification
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol (optimized stability)
Concentration0.1–1.0 mg/mL (reconstituted in sterile water)
StabilityShelf life: 6 months (-20°C/-80°C, liquid); 12 months (lyophilized)

Commercial Suppliers (Global):

SupplierProduct CodeKey Features
CUSABIO Technology LLCCSB-BP879975DZV1Partial sequence, baculovirus expression
VBRCCF391496AUXELISA-compatible, Arabis hirsuta origin

Genomic Context

The cemA gene is located in the large single-copy (LSC) region of the chloroplast genome, along with other genes critical for photosynthesis (e.g., rbcL, psaA) . In Arabis stellari, comparative analyses revealed:

  • High GC Content: 36.4% genome-wide, with IR regions enriched in rRNA genes .

  • Gene Duplications: 14 genes (including cemA) contain introns, suggesting evolutionary complexity .

Proteomic Findings

Proteomic studies in Arabidopsis thaliana identified envelope membrane proteins involved in:

  1. Transport: Phosphate carriers, metabolite shuttles.

  2. Protein Import: Components of the TIC-TOC complexes.

  3. Lipid Metabolism: Enzymes for galactolipid synthesis .

While direct data for Arabis hirsuta cemA is limited, homology to Arabidopsis proteins suggests analogous roles .

Phylogenetic Relationships

Phylogenetic studies highlight:

  • Close Affinity: Arabis hirsuta clusters with Arabis flagellosa, diverging from Arabis paniculata .

  • Conserved Genes: cemA is retained across Brassicaceae, indicating functional importance .

Variable Regions and Selective Pressure

Comparative genomics identified cemA as one of the most variable genes in Arabis chloroplast genomes, alongside matK and ycf1 . This variability may reflect adaptation to environmental stresses, such as heavy metal tolerance in hyperaccumulators like Arabis paniculata .

ELISA and Antibody Development

Recombinant cemA is utilized in immunoassays to study:

  • Protein Localization: Confirming membrane integration.

  • Functional Interactions: Mapping binding partners in chloroplast networks .

Model Organism Studies

Arabis hirsuta serves as a model for:

  1. Chloroplast Division: Investigating membrane dynamics during organelle replication.

  2. Heavy Metal Stress: Assessing cemA’s role in detoxification pathways .

Technical Challenges

  • Low Yield: Recombinant cemA production requires optimized expression systems .

  • Functional Ambiguity: Exact biochemical roles remain unclear, necessitating further structural studies.

Research Priorities

  1. Structural Biology: X-ray crystallography or cryo-EM to resolve cemA’s membrane topology.

  2. Functional Knockouts: CRISPR-edited Arabis hirsuta to study phenotypic effects of cemA deficiency.

  3. Cross-Species Comparisons: Contrasting cemA roles in hyperaccumulators vs. non-accumulators .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFFYFTSIVFLPWLISLCCNKSLKIWITNWWNTRQCETFLNDIQEKSVLEKF IQLEDLFQLDEMIKEYPETDLQQFRLGIHKETIQFIKIHNEYHIHTILHFSTNLISFVIL SGYSFWGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

How conserved is the cemA protein across different plant species?

The cemA protein shows variable conservation patterns across plant species. Comparative genomic analyses reveal that while certain regions of the protein are highly conserved, others show considerable variation, reflecting evolutionary adaptations to different photosynthetic requirements.

Table 1: Conservation of cemA across selected plant species

SpeciesSimilarity to A. hirsuta cemAKey differencesReference
A. nipponica>99.9%Minimal variation
A. flagellosa>99.9%Minimal variation
Oenothera argillicola~70%Variations in N-terminal region
Other East Asian Arabis species>99.9%<0.1% nucleotide differences

Structural analyses of cemA across different species indicate that three amino acids at positions 2 (threonine), 12 (arginine), and 15 (alanine) in the loop1 region are particularly conserved and likely critical for protein function . Research has shown that divergence between A. hirsuta and A. nipponica cemA differs by approximately 2.4% per site (about 3500 nucleotide sites), while variation within East Asian Arabis species is significantly lower (<0.1% per site) .

What methodologies are most effective for expressing and purifying recombinant A. hirsuta cemA protein?

Successful expression and purification of recombinant A. hirsuta cemA requires specialized methodologies due to its membrane protein nature:

Expression Systems:

  • E. coli-based expression: The most common approach utilizes E. coli with codon optimization for the hydrophobic membrane protein . Expression vectors containing N-terminal His-tags facilitate purification while minimizing interference with protein folding and membrane insertion.

  • Cell-free expression systems: For challenging membrane proteins, cell-free systems can provide advantages by eliminating cellular toxicity issues.

Purification Protocol:

  • Bacterial cell lysis using specialized buffers containing detergents (typically 1% n-dodecyl-β-D-maltoside or 1% Triton X-100)

  • Initial purification via immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  • Secondary purification through size exclusion chromatography

  • Final concentration adjustment to 0.1-1.0 mg/mL in Tris/PBS-based buffer with 6% trehalose (pH 8.0)

For long-term storage, the addition of 5-50% glycerol and storage at -20°C/-80°C is recommended to maintain protein stability and functionality . Repeated freeze-thaw cycles should be avoided, with working aliquots maintained at 4°C for up to one week .

How can researchers investigate the structure-function relationship of cemA in photosynthetic processes?

Investigating structure-function relationships of cemA requires multi-faceted approaches:

Structural Analysis Techniques:

  • X-ray crystallography or cryo-EM: Though challenging for membrane proteins, these methods can reveal the three-dimensional structure of cemA, particularly when expressed with fusion partners that enhance solubility.

  • Circular dichroism spectroscopy: Useful for determining secondary structure elements and thermal stability of the protein in different detergent environments.

Functional Assays:

  • CO₂ uptake measurements: Using radioactively labeled CO₂ to assess transport facilitation by wild-type versus mutant cemA proteins.

  • Reconstitution in liposomes: Purified cemA can be reconstituted into artificial membrane systems to assess ion or small molecule transport capabilities under controlled conditions.

Mutagenesis Approaches:
Site-directed mutagenesis targeting conserved residues, particularly the three critical amino acids (threonine2, arginine12, and alanine15) identified in loop1 region , followed by functional assays can reveal the contribution of specific residues to cemA function. Chimeric constructs combining domains from cemA proteins of different species can further elucidate domain-specific functions.

What does the evolutionary history of cemA tell us about chloroplast capture events in Arabis species?

The cemA gene provides valuable insights into chloroplast capture events in Arabis species:

Evidence of Chloroplast Capture:
Chloroplast capture occurs when the chloroplast of one plant species is introgressed into another plant species through hybridization followed by repeated backcrossing . Phylogenetic analyses reveal incongruence between nuclear and chloroplast markers in East Asian Arabis species, strongly indicating chloroplast capture events .

Genomic Evidence:

  • The extremely low divergence (~0.1% per site) between cemA sequences of East Asian Arabis species compared to the much higher divergence between these species and A. hirsuta (~2.4% per site) supports recent chloroplast capture events .

  • The entire chloroplast genome, including the cemA gene, shows similar patterns of conservation among East Asian Arabis species (A. nipponica, A. flagellosa), suggesting unified chloroplast evolutionary history despite divergent nuclear histories.

Evolutionary Rate Analysis:
The divergence levels between East Asian Arabis species' chloroplast genomes are comparable to variation levels within local A. alpina populations (approximately Waterson's θ = 0.02%), suggesting very recent evolutionary separation or ongoing genetic exchange .

This evolutionary history provides a valuable model system for studying organellar genome capture and the mechanisms that maintain nuclear-chloroplast genome compatibility despite hybridization events.

What are the optimal conditions for studying cemA protein interactions with other chloroplast proteins?

Studying protein-protein interactions involving membrane proteins like cemA requires specialized approaches:

In Vitro Interaction Studies:

  • Pull-down assays: Using recombinant His-tagged cemA protein as bait, researchers can identify interacting partners from chloroplast extracts. Crosslinking agents may be necessary to capture transient interactions.

  • Surface plasmon resonance (SPR): Allows real-time monitoring of cemA interactions with potential partners under varying conditions (pH, salt concentration, temperature).

Optimized Buffers for Interaction Studies:

ComponentRangeOptimization Notes
pH7.0-8.5Test at 0.5 pH intervals
NaCl50-300 mMHigher concentration reduces non-specific binding
Detergent0.01-0.1%Must be above CMC but minimized to prevent disruption of interactions
Divalent cations1-5 mM MgCl₂ or CaCl₂Often required for functional interactions

In Vivo Approaches:

  • Bimolecular fluorescence complementation (BiFC) in plant protoplasts transiently expressing cemA constructs fused to split fluorescent protein fragments.

  • Co-immunoprecipitation from intact chloroplasts following crosslinking to capture physiologically relevant interactions.

The experimental design should include proper controls, such as testing interactions with known non-interacting proteins and using cemA mutants with altered binding capabilities as negative controls.

How can researchers effectively analyze the impact of cemA mutations on chloroplast function?

A comprehensive approach to analyzing cemA mutations includes:

Generation of Mutation Libraries:

  • Alanine-scanning mutagenesis: Systematically replacing each amino acid with alanine to identify functionally important residues.

  • Domain-specific mutations: Targeting regions showing high conservation across species, particularly the three key amino acids in the loop1 region (threonine2, arginine12, and alanine15) .

Functional Assays:

  • Chloroplast isolation and functional assessment: Measuring photosynthetic parameters (oxygen evolution, electron transport rates, CO₂ fixation) in chloroplasts containing wild-type versus mutant cemA.

  • In vivo chlorophyll fluorescence imaging: Non-invasive assessment of photosystem II efficiency in plants expressing cemA variants.

Phenotypic Characterization:
Comprehensive phenotyping under varying CO₂ concentrations, light intensities, and temperature conditions can reveal condition-dependent effects of cemA mutations on plant growth and development.

Data Analysis Framework:
Integration of phenotypic, biochemical, and biophysical data requires multivariate statistical approaches to identify patterns and correlations between specific mutations and observed functional changes.

What techniques are most reliable for studying cemA localization and dynamics within chloroplast membranes?

Multiple complementary approaches provide comprehensive information about cemA localization and dynamics:

Microscopy-Based Methods:

  • Confocal microscopy with fluorescent protein fusions: EYFP-tagged cemA constructs allow visualization of localization patterns, though care must be taken to ensure tags don't interfere with targeting signals .

  • Super-resolution microscopy (STORM, PALM): Provides nanoscale resolution of cemA distribution patterns within chloroplast envelope membranes.

Biochemical Fractionation:

  • Chloroplast isolation followed by membrane fractionation: Separation of inner and outer envelope membranes through sucrose gradient centrifugation, followed by immunoblotting to detect cemA.

  • Protease protection assays: Determining the topology of cemA within the membrane by assessing accessibility to proteases from different sides of the membrane.

Dynamic Studies:

  • Fluorescence recovery after photobleaching (FRAP): Measures lateral mobility of fluorescently-tagged cemA within the membrane.

  • Single-particle tracking: Using quantum dots or other small fluorescent tags to follow individual cemA molecules.

The most reliable approach combines multiple techniques to overcome limitations of individual methods, providing complementary data on both static localization and dynamic behavior.

What bioinformatic tools and databases are most valuable for comparative analysis of cemA across species?

Comprehensive bioinformatic analysis of cemA requires multiple specialized tools:

Sequence Analysis Tools:

  • Multiple sequence alignment programs: MUSCLE or MAFFT for aligning cemA sequences from diverse species, with parameters optimized for membrane proteins.

  • Visualization tools: Jalview or WebLogo for identifying conserved motifs and variable regions.

Structural Prediction Tools:

  • Membrane protein topology prediction: TMHMM or TOPCONS for predicting transmembrane domains.

  • 3D structure prediction: AlphaFold2 has dramatically improved membrane protein structure prediction capabilities.

Evolutionary Analysis Software:

  • PAML: For detecting sites under positive selection and evolutionary rate analysis .

  • MEGA X: For constructing phylogenetic trees and calculating divergence rates between species.

Specialized Databases:

  • ChloroMitoSSRDB: For analyzing simple sequence repeats (SSRs) in chloroplast genomes .

  • UniProt: For functional annotation and cross-referencing with other protein families.

For comprehensive analysis, researchers should particularly focus on cemA variable regions (>0.03) that are associated with photosynthetic processes, as these likely represent adaptations to different environmental conditions .

How should researchers interpret contradictory findings regarding cemA function in different experimental systems?

When faced with contradictory findings regarding cemA function, researchers should:

Systematic Analysis Framework:

  • Evaluate experimental systems: Different expression systems (E. coli vs. plant-based), buffer compositions, and assay conditions can significantly impact observed functions of membrane proteins like cemA.

  • Consider species-specific variations: Despite high sequence similarity, small variations in cemA sequence between species (such as the 2.4% divergence between A. hirsuta and A. nipponica) may confer different functional properties .

Reconciliation Strategies:

  • Direct comparative studies: Design experiments that test cemA from different species under identical conditions to directly compare functional properties.

  • Domain swapping experiments: Create chimeric proteins by swapping domains between cemA variants that show different functions to identify which regions are responsible for functional differences.

Data Integration Approach:
Create a comprehensive data matrix that maps experimental conditions against observed functions, enabling identification of condition-dependent effects that might explain contradictory findings. This approach often reveals that apparent contradictions reflect different aspects of a complex, multi-functional protein rather than actual contradictions.

What significance do simple sequence repeats (SSRs) in cemA and surrounding genomic regions have for evolutionary studies?

Simple sequence repeats (SSRs) in and around the cemA gene provide valuable evolutionary insights:

Role in Evolutionary Studies:
SSRs represent highly variable markers that can provide higher resolution for evolutionary studies than coding sequences alone. Analysis of the chloroplast genomes in Arabis species identified 74 mono-nucleotide, 22 di-nucleotide, and 2 tri-nucleotide repeat regions of ≥10 base pairs in length .

Applications in Arabis Research:

  • Population genetics: SSRs can reveal fine-scale population structure not detectable through coding sequence analysis.

  • Chloroplast capture detection: The pattern of SSR sharing between species can provide evidence of chloroplast capture events, complementing coding sequence analyses.

Methodological Approach:
For optimal SSR analysis in evolutionary studies, researchers should:

  • Use specialized software like REPuter to identify repeat sequences, with parameters set to detect Hamming distance of 3, minimum sequence identity of 90%, and repeat sizes >30 bp .

  • Apply Phobos software (v1.0.6) to comprehensively identify SSRs in chloroplast genomes surrounding the cemA region .

  • Develop SSR markers specifically targeting the most variable repeats for high-resolution population genetic studies.

These high-resolution markers can help resolve evolutionary relationships among closely related East Asian Arabis species where coding sequence divergence is extremely low (<0.1% per site) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.