Recombinant Arabis hirsuta NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: If you require a specific tag type, please inform us; we will prioritize development to meet your specifications.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEVFIFVLILILGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. NDH couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 and what is its function in plant systems?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a chloroplastic protein that functions as part of the NAD(P)H dehydrogenase complex in plant systems. This enzyme catalyzes the reduction of quinone metabolites using NAD(P)H as an electron donor, similar to its mammalian counterparts. In plants, this protein is localized in the chloroplast and plays a critical role in cyclic electron flow around photosystem I, contributing to ATP synthesis without NADPH production. The enzyme is part of the NDH complex that helps plants adapt to various environmental stresses, particularly under conditions where linear electron transport is insufficient to meet energy demands .

How does the structure of Arabis hirsuta NAD(P)H-quinone oxidoreductase subunit 3 compare to other plant species?

The NAD(P)H-quinone oxidoreductase subunit 3 from Arabis hirsuta shows significant structural conservation with homologous proteins from other plant species. The protein contains characteristic transmembrane domains consistent with its role as a membrane-embedded component of the NDH complex. Sequence analysis indicates conserved functional domains that are crucial for electron transfer and quinone binding. Unlike the related subunit 4L (which has 101 amino acids), the subunit 3 is composed of 120 amino acids . Comparative genomics studies suggest that while the core functional domains remain conserved across plant species, variations in specific amino acid residues may contribute to species-specific adaptations to different environmental conditions.

What are the optimal storage and handling conditions for Recombinant Arabis hirsuta NAD(P)H-quinone oxidoreductase subunit 3?

For optimal preservation of enzymatic activity and structural integrity, Recombinant Arabis hirsuta NAD(P)H-quinone oxidoreductase subunit 3 should be stored under the following conditions:

  • Storage Temperature: Store at -20°C for regular use; for extended preservation, store at -20°C to -80°C

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Handling Recommendations:

    • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

    • Prepare working aliquots and store at 4°C for up to one week

    • When handling, minimize exposure to room temperature

    • Use appropriate sterile techniques to prevent contamination

These storage and handling guidelines help maintain the enzymatic activity and structural integrity of the protein for experimental applications.

What are the recommended methods for assessing NAD(P)H-quinone oxidoreductase activity in experimental systems?

When assessing NAD(P)H-quinone oxidoreductase activity in experimental systems, researchers should consider multiple methodological approaches:

  • Spectrophotometric Assays:

    • Monitor the decrease in NADPH absorption at 340 nm

    • Use dicoumarol as a specific inhibitor to confirm specificity

    • Include appropriate controls to account for non-specific NADPH oxidation

  • Enzyme Kinetics Analysis:

    • Determine Km values for both NADPH and quinone substrates

    • Measure Vmax under varying substrate concentrations

    • Calculate catalytic efficiency (kcat/Km) for complete enzymatic characterization

  • In-gel Activity Assays:

    • Perform native PAGE followed by activity staining with NBT and PMS

    • Use gradient gels (4-15%) for optimal separation of the NDH complex

  • Oxygen Consumption Measurements:

    • Utilize Clark-type oxygen electrodes to measure oxygen consumption rates

    • Compare rates with and without specific inhibitors

These methodological approaches provide comprehensive assessment of enzyme activity and can be adapted based on specific research questions and available equipment.

How can researchers effectively reconstitute and prepare Recombinant Arabis hirsuta NAD(P)H-quinone oxidoreductase subunit 3 for functional studies?

For effective reconstitution and preparation of Recombinant Arabis hirsuta NAD(P)H-quinone oxidoreductase subunit 3:

  • Initial Reconstitution:

    • Thaw the protein stock slowly on ice to prevent denaturation

    • Avoid vortexing; instead, mix gently by pipetting or inversion

    • If precipitates form, centrifuge at 10,000 × g for 5 minutes at 4°C

  • Buffer Optimization:

    • For membrane protein reconstitution, use buffers containing non-ionic detergents (0.1-0.5% n-dodecyl-β-D-maltoside)

    • Include stabilizing agents such as glycerol (10-20%) and reducing agents (1-5 mM DTT)

    • Maintain pH between 7.0-7.5 for optimal stability

  • Proteoliposome Preparation (for membrane protein studies):

    • Prepare liposomes using plant chloroplast lipids (MGDG, DGDG, SQDG, and PG)

    • Use lipid-to-protein ratios of 50:1 to 100:1

    • Remove detergent gradually using Bio-Beads or dialysis

  • Activity Verification:

    • Perform enzyme activity assays immediately after reconstitution

    • Compare with native protein activity to ensure proper folding

    • Include FMN or FAD cofactors (1-10 μM) if required for full activity

This systematic approach ensures that the recombinant protein maintains its native conformation and functional properties for subsequent experimental applications.

How does NAD(P)H-quinone oxidoreductase subunit 3 contribute to oxidative stress responses in plant systems?

NAD(P)H-quinone oxidoreductase subunit 3 plays a crucial role in plant oxidative stress responses through several mechanisms:

  • Reactive Oxygen Species (ROS) Management:

    • The enzyme prevents the accumulation of highly reactive quinones that can generate ROS

    • It catalyzes the two-electron reduction of quinones to hydroquinones, bypassing the formation of semiquinone radicals

    • This action directly prevents oxidative damage to cellular components

  • Redox Homeostasis Maintenance:

    • As part of the NDH complex, it helps maintain the NADPH/NADP+ ratio

    • Contributes to cyclic electron flow around photosystem I, which provides ATP without net production of reducing equivalents

    • This process is upregulated under stress conditions when linear electron transport is compromised

  • Stress Adaptation Mechanism:

    • Expression studies have shown upregulation of ndhC under various abiotic stresses

    • It participates in chlororespiration pathways that become more active during stress

    • Knockout studies in model plants demonstrate increased sensitivity to oxidative stress when NDH complex function is impaired

The integration of NAD(P)H-quinone oxidoreductase subunit 3 into these stress response networks highlights its importance beyond basic metabolic functions, positioning it as a key player in plant adaptation to fluctuating environmental conditions.

What are the challenges and strategies for expressing functional Arabis hirsuta NAD(P)H-quinone oxidoreductase subunit 3 in heterologous systems?

Expressing functional Arabis hirsuta NAD(P)H-quinone oxidoreductase subunit 3 in heterologous systems presents several challenges that require specific strategies:

Challenges and Solutions Table:

ChallengeDescriptionStrategic Solutions
Membrane protein expressionAs a hydrophobic transmembrane protein, expression often results in aggregation or inclusion body formation- Use specialized E. coli strains (C41, C43) designed for membrane protein expression
- Express as fusion with solubility-enhancing tags (MBP, SUMO)
- Reduce expression temperature to 16-20°C
Proper foldingChloroplastic proteins require specific chaperones for correct folding- Co-express with chloroplast-specific chaperones
- Include molecular chaperones (GroEL/ES) in expression systems
- Use cell-free translation systems supplemented with lipid nanodiscs
Post-translational modificationsPotential modifications may be required for full functionality- Consider yeast or insect cell expression systems
- Use plant-based expression systems (tobacco BY-2 cells)
- Employ chloroplast transformation in model plants
Complex assemblyFunctions as part of a multi-subunit complex- Co-express with other NDH complex subunits
- Design constructs for coordinated expression of multiple subunits
- Utilize pull-down assays to validate complex formation
Activity assessmentDifficult to measure activity of isolated subunits- Reconstitute with minimal complex components
- Design activity assays specific for partial reactions
- Use artificial electron acceptors to bypass complex requirements

Implementation of these strategies requires careful optimization based on the specific research objectives and available resources, with pilot experiments to determine the most effective approach for each heterologous system.

How can researchers investigate the interaction between NAD(P)H-quinone oxidoreductase subunit 3 and other components of the NDH complex?

Investigating the interactions between NAD(P)H-quinone oxidoreductase subunit 3 and other NDH complex components requires a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP) Studies:

    • Generate antibodies against specific epitopes of the subunit 3 protein

    • Perform Co-IP followed by mass spectrometry analysis to identify interacting partners

    • Use crosslinking agents to stabilize transient interactions before immunoprecipitation

    • Verify interactions using reciprocal Co-IP with antibodies against potential partners

  • Yeast Two-Hybrid (Y2H) and Split-Ubiquitin Systems:

    • For membrane proteins, use split-ubiquitin membrane Y2H systems

    • Screen libraries of NDH complex components against bait constructs

    • Validate positive interactions with quantitative β-galactosidase assays

    • Address potential false positives through secondary confirmation methods

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse potential interacting proteins with complementary fragments of fluorescent proteins

    • Express in plant protoplasts or through transient transformation

    • Analyze subcellular localization of reconstituted fluorescence

    • Perform controls with mutated interaction domains to confirm specificity

  • Cryo-Electron Microscopy and Structural Analysis:

    • Purify intact NDH complexes through affinity chromatography

    • Perform single-particle cryo-EM analysis to determine structural organization

    • Use computational modeling to predict interaction interfaces

    • Validate structural predictions through site-directed mutagenesis of interface residues

  • Protein Crosslinking Mass Spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize protein-protein interactions

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Identify crosslinked peptides to map interaction sites

    • Generate distance restraints for molecular modeling

How does Arabis hirsuta NAD(P)H-quinone oxidoreductase subunit 3 compare structurally and functionally to subunit 4L?

Arabis hirsuta contains distinct NAD(P)H-quinone oxidoreductase subunits that exhibit important structural and functional differences:

Comparative Features of NAD(P)H-quinone oxidoreductase Subunits 3 and 4L:

FeatureSubunit 3 (ndhC)Subunit 4L (ndhE)Significance
Amino Acid Length120 amino acids 101 amino acids Subunit 3 is ~19% larger
Amino Acid SequenceMFLLYEYDIFWAFLII SSAIPVLAFLISGVL SPIRKGPEKLSSYES GIEPIGDAWLQFRIR YYMFALVFVVFDVET VFLYPWAMSFDVLGV SAFIEVFIFVLILIL GLVYAWRKGALEWS MILEHVLVLSAYL FLIGLYGLITSRN MVRALMCLELIL NAVNMNFVTFSD FFDNSQLKGDIF CIFVIAIAAAEI AIGLAIVSSIYRNRK STRINQSILLNK Limited sequence homology despite functional relatedness
Uniprot IDA4QK23 A4QK72 Different protein identifiers in databases
Transmembrane DomainsMultiple transmembrane segments with hydrophobic characterMultiple transmembrane segments with hydrophobic characterBoth are integral membrane proteins
Position in NDH ComplexCore subunit in membrane armPeripheral subunit in membrane domainDifferent spatial positioning affects electron transfer pathways
Evolutionary ConservationHighly conserved across plant speciesModerately conserved with greater sequence variationSuggests different selective pressures
Functional RoleEssential for electron transfer from NAD(P)H to quinoneInvolved in proton pumping and complex stabilityComplementary but distinct functions

What insights can be gained from studying NAD(P)H-quinone oxidoreductase homologs across different plant species?

Studying NAD(P)H-quinone oxidoreductase homologs across different plant species provides valuable insights into evolutionary adaptation, functional conservation, and specialized roles:

  • Evolutionary Conservation Patterns:

    • Core functional domains show high conservation across species, indicating essential roles

    • Variable regions suggest adaptation to different environmental niches

    • Sequence analysis reveals evolutionary pressure points related to specific functions

    • Phylogenetic analysis can track the co-evolution with photosynthetic systems

  • Functional Adaptation Mechanisms:

    • Species adapted to high light conditions often show modifications in NDH complex subunits

    • Drought-resistant plants may exhibit specific amino acid substitutions affecting enzyme efficiency

    • C4 and CAM plants show specialized adaptations in NDH complex components

    • These adaptations provide insights into structure-function relationships

  • Regulatory Network Evolution:

    • Promoter regions and transcriptional regulation mechanisms vary across species

    • Post-translational modification sites show evolutionary divergence

    • Stress-responsive elements in gene regulatory regions reflect ecological adaptations

    • Comparison of expression patterns under stress conditions reveals functional diversification

  • Applied Research Implications:

    • Identification of superior variants from stress-tolerant species

    • Engineering of optimized versions for improved plant performance

    • Development of species-specific antibodies and analytical tools

    • Prediction of functional consequences of natural variation

Comparative genomic and proteomic approaches across diverse plant species thus provide a powerful framework for understanding both the core conserved functions and the specialized adaptations of NAD(P)H-quinone oxidoreductase systems in response to diverse ecological challenges.

How has the function of NAD(P)H-quinone oxidoreductase evolved between prokaryotic and eukaryotic systems?

The evolution of NAD(P)H-quinone oxidoreductase from prokaryotic to eukaryotic systems represents a fascinating case of functional adaptation and repurposing:

  • Evolutionary Origin and Divergence:

    • Plant NDH complexes originated from cyanobacterial ancestors during endosymbiosis

    • Chloroplast NAD(P)H-quinone oxidoreductase subunits show homology to bacterial respiratory complex I components

    • While bacterial complex I primarily functions in respiration, plant NDH complex has been repurposed for cyclic electron flow in photosynthesis

    • This functional shift represents a key evolutionary innovation in plant energy metabolism

  • Structural Adaptations:

    • Prokaryotic enzymes typically have simpler subunit composition (10-14 subunits)

    • Plant NDH complexes have acquired additional plant-specific subunits (>25 total)

    • These plant-specific subunits facilitate integration with photosynthetic apparatus

    • Structural studies show reorganization of core subunits to accommodate new functions

  • Functional Specialization:

    • Bacterial enzymes primarily couple NADH oxidation to proton pumping for ATP synthesis

    • Plant enzymes have evolved specialized roles in cyclic electron flow and chlororespiration

    • Plant NDH complexes show modified quinone-binding sites optimized for plastoquinone

    • Regulatory mechanisms have evolved to coordinate activity with photosynthetic electron transport

  • Comparative Enzyme Kinetics:

    • Bacterial enzymes typically show higher turnover rates (kcat)

    • Plant enzymes often exhibit higher substrate affinity (lower Km values)

    • These kinetic differences reflect adaptation to different metabolic contexts

    • Plant enzymes have evolved regulatory mechanisms responsive to light conditions

This evolutionary transition illustrates how protein complexes can be repurposed for new functions while maintaining core catalytic mechanisms, providing insights into the adaptability of electron transport systems across diverse biological contexts.

What are the potential applications of recombinant NAD(P)H-quinone oxidoreductase in stress tolerance research?

Recombinant NAD(P)H-quinone oxidoreductase offers multiple applications in stress tolerance research, providing tools to understand and enhance plant resilience:

  • Biomarker Development for Stress Responses:

    • The enzyme can serve as a molecular indicator of oxidative stress levels

    • Changes in expression and activity correlate with various abiotic stresses

    • Development of antibody-based or activity-based assays can provide quantitative stress metrics

    • These biomarkers could enable early detection of stress responses before visible symptoms appear

  • Genetic Engineering Approaches:

    • Overexpression of optimized NAD(P)H-quinone oxidoreductase variants in crop plants

    • CRISPR-Cas9 modification of regulatory regions to enhance stress-responsive expression

    • Creation of chimeric enzymes combining features from stress-tolerant species

    • These approaches could enhance plant resilience to drought, high light, and temperature stresses

  • Mechanistic Studies of Oxidative Stress Protection:

    • Use of recombinant protein to identify specific quinone substrates relevant to stress conditions

    • In vitro reconstitution studies to determine antioxidant capacity under various conditions

    • Identification of regulatory post-translational modifications induced by stress

    • These studies provide fundamental insights into stress response mechanisms

  • High-Throughput Screening Applications:

    • Development of cell-based assays using recombinant enzyme as a reporter

    • Screening chemical libraries for compounds that enhance enzyme activity or stability

    • Identification of natural products that modulate NDH complex function

    • These screening platforms could identify novel stress-protective compounds

These research applications highlight the versatility of recombinant NAD(P)H-quinone oxidoreductase as both a research tool and potential target for enhancing plant stress tolerance in agricultural applications .

How can researchers investigate the role of NAD(P)H-quinone oxidoreductase in chloroplast redox homeostasis?

Investigating the role of NAD(P)H-quinone oxidoreductase in chloroplast redox homeostasis requires a multi-dimensional experimental approach:

  • Real-time Redox Monitoring Techniques:

    • Utilize redox-sensitive fluorescent proteins (roGFP) targeted to chloroplasts

    • Employ genetically encoded NAD(P)H sensors to track redox dynamics

    • Apply microelectrode techniques to measure compartment-specific redox potentials

    • These approaches provide spatiotemporal resolution of redox changes during stress

  • Genetic Manipulation Strategies:

    • Generate knockdown/knockout lines using RNAi or CRISPR-Cas9

    • Create conditional mutants using inducible promoters to control expression

    • Develop complementation lines with site-directed mutants targeting catalytic residues

    • Compare redox status across these genetic backgrounds under various conditions

  • Metabolomic and Proteomic Analyses:

    • Quantify NAD(P)H/NAD(P)+ ratios using LC-MS/MS techniques

    • Profile quinone/hydroquinone pools to assess enzyme activity in vivo

    • Perform redox proteomics to identify proteins affected by altered NDH function

    • Integrate data to create comprehensive models of chloroplast redox networks

  • Physiological and Biophysical Measurements:

    • Measure chlorophyll fluorescence parameters (NPQ, Fv/Fm) to assess photosystem status

    • Employ P700 absorbance changes to monitor cyclic electron flow

    • Analyze gas exchange parameters to link redox status to photosynthetic output

    • Use these measurements to connect molecular changes to whole-plant physiology

  • Computational Modeling Approaches:

    • Develop kinetic models of the NDH complex within electron transport networks

    • Simulate redox perturbations under various environmental conditions

    • Predict compensatory mechanisms when NDH function is altered

    • Validate model predictions through targeted experiments

This comprehensive research strategy enables a systematic understanding of how NAD(P)H-quinone oxidoreductase contributes to maintaining redox balance in chloroplasts, particularly under fluctuating environmental conditions that challenge photosynthetic electron transport.

What novel methodologies are emerging for studying the structural dynamics of NAD(P)H-quinone oxidoreductase in membrane systems?

Emerging methodologies for studying structural dynamics of NAD(P)H-quinone oxidoreductase in membrane systems are revolutionizing our understanding of this complex:

  • Advanced Cryo-Electron Microscopy Techniques:

    • Time-resolved cryo-EM captures conformational changes during catalytic cycles

    • Cryo-electron tomography provides insights into in situ organization within thylakoid membranes

    • Focused ion beam milling combined with cryo-EM enables visualization in native membrane contexts

    • These approaches reveal dynamic structural rearrangements previously undetectable

  • Single-Molecule Biophysics Approaches:

    • Single-molecule FRET to measure distance changes between labeled domains

    • High-speed atomic force microscopy to visualize conformational dynamics in real-time

    • Optical tweezers to probe mechanical properties during substrate binding and catalysis

    • These techniques provide unprecedented resolution of enzyme dynamics at the nanoscale

  • Advanced Spectroscopic Methods:

    • Solid-state NMR of isotopically labeled proteins in nanodiscs

    • Electron paramagnetic resonance (EPR) spectroscopy to track electron transfer pathways

    • Time-resolved infrared spectroscopy to follow proton translocation events

    • These spectroscopic approaches provide atomic-level insights into catalytic mechanisms

  • Computational Approaches:

    • Molecular dynamics simulations of entire NDH complexes in lipid bilayers

    • Quantum mechanics/molecular mechanics (QM/MM) calculations of electron transfer energetics

    • Machine learning approaches to predict conformational ensembles from limited experimental data

    • These computational methods bridge experimental gaps and generate testable hypotheses

  • Synthetic Biology Platforms:

    • Designer nanodiscs with controlled lipid composition

    • Minimal synthetic membranes reconstituted with defined components

    • DNA origami scaffolds to position NDH complexes at precise orientations

    • These synthetic systems enable precise control over the membrane environment

Integration of these emerging methodologies provides a comprehensive view of NAD(P)H-quinone oxidoreductase structural dynamics within membrane systems, advancing our understanding beyond static structural snapshots to dynamic functional mechanisms.

What are the most significant knowledge gaps in our understanding of NAD(P)H-quinone oxidoreductase in plant systems?

Despite significant progress, several critical knowledge gaps remain in our understanding of NAD(P)H-quinone oxidoreductase in plant systems:

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology, ultimately advancing our fundamental understanding of photosynthetic energy conversion and plant stress responses .

How might future research on NAD(P)H-quinone oxidoreductase contribute to agricultural applications?

Future research on NAD(P)H-quinone oxidoreductase holds significant promise for agricultural applications, particularly in developing crops with enhanced stress resilience:

  • Climate Resilience Engineering:

    • Identification of naturally occurring enzyme variants from extremophile plants

    • Development of crops with optimized NDH complex components for drought tolerance

    • Enhancement of cyclic electron flow to improve photosynthetic efficiency under heat stress

    • These approaches could produce crops better adapted to climate change conditions

  • Precision Agriculture Tools:

    • Development of biosensors based on NAD(P)H-quinone oxidoreductase activity

    • Creation of reporter plants that visualize oxidative stress through fluorescent proteins

    • Field-deployable diagnostic tools to detect stress before visible symptoms appear

    • These technologies could enable early intervention and targeted resource application

  • Novel Breeding Targets:

    • Identification of genetic markers associated with superior NDH complex function

    • Discovery of regulatory elements controlling stress-responsive expression

    • Development of high-throughput phenotyping methods for NDH-related traits

    • These breeding tools could accelerate improvement of stress tolerance traits

  • Metabolic Engineering Opportunities:

    • Optimization of electron flux distribution for enhanced photosynthetic efficiency

    • Engineering of NDH complexes with improved thermostability for hot environments

    • Development of plants with enhanced photoprotection mechanisms

    • These metabolic improvements could increase crop productivity under suboptimal conditions

  • Sustainability Applications:

    • Reduced crop losses due to environmental stresses

    • Decreased requirements for irrigation and chemical interventions

    • Expanded cultivation potential in marginal lands

    • These sustainability benefits align with global food security challenges

The translation of fundamental research on NAD(P)H-quinone oxidoreductase into agricultural applications represents a promising frontier for addressing food security challenges in a changing climate, particularly for crops grown under increasingly variable and stressful environmental conditions.

What interdisciplinary approaches show the most promise for advancing our understanding of NAD(P)H-quinone oxidoreductase function?

Advancing our understanding of NAD(P)H-quinone oxidoreductase function will benefit most from integrative interdisciplinary approaches that bridge traditional research boundaries:

  • Integration of Structural Biology with Systems Biology:

    • Combining atomic-resolution structures with genome-scale metabolic models

    • Mapping protein-protein interaction networks within and beyond the NDH complex

    • Correlating structural features with system-level responses to environmental perturbations

    • This integration connects molecular mechanisms to cellular and organismal phenotypes

  • Computational Biology and Artificial Intelligence:

    • Machine learning approaches to predict structure-function relationships

    • Network analysis to identify regulatory hubs in stress response pathways

    • Molecular dynamics simulations to explore conformational landscapes

    • These computational approaches generate hypotheses and guide experimental design

  • Synthetic Biology and Bioengineering:

    • Creation of minimal synthetic systems to test fundamental mechanisms

    • Design of novel enzyme variants with enhanced properties

    • Development of optogenetic tools to control enzyme activity with light

    • These approaches enable precise manipulation and testing of design principles

  • Field Biology and Ecological Genomics:

    • Studying natural variation in enzyme function across ecological gradients

    • Conducting field trials to validate laboratory findings in complex environments

    • Exploring biodiversity to discover novel enzyme variants with unique properties

    • These ecological approaches ground mechanistic studies in evolutionary context

  • Multi-omics Integration with Phenomics:

    • Correlating transcriptomic, proteomic, and metabolomic data with phenotypic outcomes

    • Developing high-throughput phenotyping platforms for NDH-related traits

    • Creating predictive models linking molecular signatures to plant performance

    • These integrative approaches connect molecular mechanisms to agronomically relevant traits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.