Recombinant Arabis hirsuta Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

2.1 PSII Core Complex Assembly
PsbB anchors chlorophyll and stabilizes the PSII reaction center, enabling:

  • Water Oxidation: Extraction of electrons from H₂O, producing O₂ and a proton gradient .

  • Electron Transfer: Coordination of light-induced redox reactions via chlorophyll a and pheophytin .

2.2 Repair and Stability
Under high light, psbB participates in PSII repair cycles:

  1. Damaged D1 Protein Replacement: PsbB remains intact while photodamaged D1 is degraded .

  2. Reassembly: Reintegration of new D1 and auxiliary subunits (e.g., CP43, oxygen-evolving complex) .

Recombinant Production and Applications

3.1 Expression Systems
PsbB is typically recombinant-expressed in E. coli with an N-terminal His-tag for purification .

ParameterDetails
Tag TypeHis-tag (e.g., Spinacia oleracea psbB )
Storage-20°C or -80°C in Tris-based buffer with 50% glycerol .
Purity>90% by SDS-PAGE .

Research Applications

  • Structural Studies: Probe chlorophyll binding sites and histidine-ligand interactions .

  • Functional Assays: Study PSII assembly dynamics in vitro .

Comparative Genomic Insights

4.1 Chloroplast Genome Context
In A. hirsuta, psbB resides in the large single-copy (LSC) region of the chloroplast genome, mirroring other Brassicaceae species . Notably:

  • Gene Conservation: Absence of rps16 and infA in Arabis plastomes, reflecting lineage-specific pseudogenization .

  • Evolutionary Links: Closer to Draba than Arabidopsis, per phylogenetic analyses .

4.2 Substitution Rates
In Arabis stellari, the Ka/Ks ratio for ndhA (a stress-related gene) vs. A. hirsuta is 1.35, suggesting relaxed purifying selection .

Key Research Findings

5.1 Structural Modeling
Electron crystallography of spinach CP47 revealed:

  • 5 Chlorophylls directly ligated to histidines (Mg²⁺ within 4 Å).

  • 7 Chlorophylls in proximity (4–8 Å), necessitating indirect coordination .

5.2 Functional Impact
PsbB mutations impair PSII activity, as seen in Oenothera hybrids with reduced psbB mRNA and CP47 levels, leading to abnormal chloroplast development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSVSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
Arabis hirsuta Photosystem II CP47 chlorophyll apoprotein (psbB) is a crucial component of the core complex in photosystem II (PSII). It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical reactions of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.