Recombinant Arabis hirsuta Photosystem Q (B) protein

Shipped with Ice Packs

In Stock

Cat. No.

BT2136912

Source

in vitro E.coli expression system

Synonyms

psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein

Quick Inquiry

Description

Product Definition and Biochemical Characteristics

The recombinant Arabis hirsuta Photosystem Q(B) protein, encoded by the psbA gene, is a core component of Photosystem II (PSII) in plants. It corresponds to the D1 subunit, critical for light-driven water oxidation and electron transport in oxygenic photosynthesis. This recombinant version is expressed in E. coli with an N-terminal His-tag for purification and structural studies .

Photosystem II Assembly and Function

The D1 protein (PsbA) interacts with auxiliary proteins like OHP1, OHP2, and HCF244 during PSII assembly. These complexes stabilize early intermediates, ensuring proper chlorophyll and carotenoid integration . In plants, mutations in auxiliary proteins (e.g., PSB33, PAM68) disrupt PSII-LHCII supercomplex formation and increase light sensitivity .

Auxiliary Protein	Role in PSII	Functional Impact
OHP1/OHP2	Stabilizes early assembly intermediates	Required for high-light acclimation
PSB33	Maintains LHCII-PSII supercomplexes	Reduces nonphotochemical quenching capacity
PAM68	Promotes D1 maturation and stability	Defects lead to reduced PSII core subunits

Chloroplast Genome Context

Arabis hirsuta’s chloroplast genome (153,541 bp) contains 79 protein-coding genes, including psbA, with codon usage biased toward leucine-rich sequences . This genomic data supports phylogenetic studies linking Arabis species to Draba in Brassicaceae .

Challenges and Future Directions

Limited species-specific data: Most PSII research focuses on Arabidopsis or cyanobacteria, necessitating extrapolation for Arabis hirsuta .
Stability concerns: Repeated freeze-thaw cycles degrade recombinant proteins, requiring optimized storage protocols .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time

Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.

Shelf Life

Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements; we will prioritize fulfilling specified tag types.

Synonyms

psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-344

Protein Length

full length protein

Species

Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta)

Target Names

psbA

Target Protein Sequence

MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Uniprot No.

A4QJZ9

Target Background

Function

Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.

Protein Families

Reaction center PufL/M/PsbA/D family

Subcellular Location

Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Arabis hirsuta Photosystem Q (B) protein

Description

Product Definition and Biochemical Characteristics

Photosystem II Assembly and Function

Chloroplast Genome Context

Challenges and Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service