Recombinant Araneus ventricosus Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

Shipped with Ice Packs
In Stock

Description

Protein Conservation and Phylogenetic Analysis

Sequence homology studies demonstrate the highly conserved nature of DAD1 across diverse taxonomic groups, indicating its evolutionary significance. The A. ventricosus DAD1 exhibits remarkable sequence identity with DAD1 proteins from other species, as shown in Table 1.

Table 1: Sequence Identity of A. ventricosus DAD1 with DAD1 from Other Species

SpeciesSequence Identity (%)
Drosophila melanogaster75.4
Xenopus laevis74.6
Homo sapiens73.1
Sus scrofa73.1
Mesocricetus auratus73.1
Rattus norvegicus73.1
Mus musculus73.1

Phylogenetic analysis places A. ventricosus DAD1 within the animal DAD1 subgroup, clearly separated from plant DAD1 proteins. Within the animal clade, it clusters specifically with other arthropod DAD1 proteins, particularly those from dipteran insects . This high degree of conservation suggests that the fundamental functions of DAD1 have been preserved throughout evolutionary history.

Role in Apoptosis Regulation

DAD1 (Defender Against Apoptotic Cell Death 1) serves as a critical anti-apoptotic factor in A. ventricosus, consistent with its function across species. Research has demonstrated that this protein plays a protective role against programmed cell death, particularly under stress conditions . This function appears to be evolutionarily conserved, with DAD1's involvement in temperature-induced apoptotic cell death reported in both A. ventricosus and the bay scallop Argopecten irradians .

Temperature Responsiveness

An intriguing aspect of A. ventricosus DAD1 is its response to temperature fluctuations. Northern blot analyses have revealed that transcript levels of the DAD1 gene increase significantly when the organism is exposed to both low (4°C) and high (37°C) temperatures . This temperature-responsive expression suggests that DAD1 may play a role in cellular adaptation to thermal stress, potentially by preventing apoptosis triggered by temperature extremes.

Tissue Distribution and Expression

Expression analysis indicates that DAD1 transcripts are present across multiple tissues in A. ventricosus. This ubiquitous expression pattern implies that DAD1 serves essential cellular functions throughout the organism's body . The widespread distribution of DAD1 across tissues aligns with its critical role in fundamental cellular processes, particularly in protein N-glycosylation and apoptosis prevention.

Role in Protein Glycosylation

As a subunit of the dolichyl-diphosphooligosaccharide--protein glycosyltransferase complex, DAD1 participates in the protein N-glycosylation pathway. This process is essential for proper protein folding, stability, and function in eukaryotic cells. The glycosyltransferase complex transfers oligosaccharide moieties from dolichol donors to nascent polypeptide chains, a critical step in the maturation of many secreted and membrane proteins .

Expression Systems and Purification

Recombinant A. ventricosus DAD1 can be successfully expressed in prokaryotic systems, particularly Escherichia coli, as a full-length protein (113 amino acids) with an N-terminal histidine tag to facilitate purification . The expression in bacterial systems yields high levels of protein that can be purified to greater than 90% homogeneity as determined by SDS-PAGE analysis .

Functional Conservation

Studies on DAD1 orthologs in various organisms provide insight into the likely functions of A. ventricosus DAD1. In the rice gall midge (Orseolia oryzae), DAD1 plays a crucial role in regulating unwanted apoptosis, particularly during interactions with host plants . Similar anti-apoptotic functions have been observed in DAD1 proteins from mammals and other invertebrates, supporting the notion that A. ventricosus DAD1 serves as a critical regulator of programmed cell death.

Glycoengineering Applications

The characterization of A. ventricosus DAD1 contributes to our understanding of protein glycosylation pathways in arthropods. This knowledge has potential applications in glycoengineering, where modification of glycosylation pathways can enhance the production of recombinant glycoproteins with specific glycan structures . The silk gland protein N-glycosylation pathway has already been successfully glycoengineered in some insects, suggesting similar approaches might be applicable using components of the A. ventricosus glycosylation machinery .

Stress Response Research

The temperature-responsive nature of A. ventricosus DAD1 expression makes it a valuable model for studying cellular responses to environmental stress. Understanding how this protein helps cells cope with temperature fluctuations could provide insights into stress adaptation mechanisms with relevance to both basic biology and biotechnological applications .

Evolutionary Biology

The high conservation of DAD1 across diverse taxonomic groups makes it an interesting subject for evolutionary studies. Comparative analyses of DAD1 from A. ventricosus and other species can shed light on the evolution of fundamental cellular processes such as apoptosis regulation and protein glycosylation .

Interaction Partners and Signaling Pathways

Further research is needed to fully characterize the interaction partners of A. ventricosus DAD1 and the signaling pathways it influences. Understanding these molecular networks could provide new insights into the mechanisms of apoptosis regulation and cell survival in arthropods.

Biotechnological Applications

The potential applications of A. ventricosus DAD1 in biotechnology warrant further exploration. Its role in glycosylation pathways suggests possible applications in the production of recombinant glycoproteins with specific modifications, which could have relevance for biopharmaceutical development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your use.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
DAD1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against apoptotic cell death 1; Defender against cell death 1; AvDAD1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Araneus ventricosus (Orbweaver spider) (Epeira ventricosa)
Target Names
Target Protein Sequence
MGSSAFEVLTFFLKDYKANTPQKLKIIDAYLLYILLTGINQFLYCCLVGTFPFNSFLSGF ISCVASFVLGVCLRLQVNPQNSSNFCGIPPERAFADFIFAHVVLHLVVMNFIG
Uniprot No.

Target Background

Function

Recombinant Araneus ventricosus Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1): A subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation. N-glycosylation is a cotranslational process, and the OST complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity.

Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Greatest expression seen in the epidermis, intermediate expression in the fat body and midgut and mild expression observed in the silk gland.

Q&A

How does recombinant A. ventricosus DAD1 differ structurally from homologs in model organisms?

Structural analysis suggests that A. ventricosus DAD1 shares core structural elements with other eukaryotic DAD1 proteins while displaying spider-specific variations. The available recombinant protein (partial sequence) preserves the characteristic transmembrane domains found in human DAD1, but exhibits species-specific amino acid substitutions that may influence substrate specificity or protein-protein interactions .

The methodological approach to investigate these differences would involve:

  • Multiple sequence alignment of A. ventricosus DAD1 with homologs from diverse organisms

  • Homology modeling based on existing DAD1 structural data

  • Molecular dynamics simulations to predict functional consequences of spider-specific residues

  • Experimental validation through site-directed mutagenesis targeting divergent residues

Current structural predictions indicate the protein contains at least three transmembrane domains, consistent with its role as an integral membrane protein within the OST complex. X-ray crystallography or cryo-EM studies would be required to resolve the precise structural details of spider DAD1, particularly in complex with other OST components .

What expression systems are optimal for recombinant A. ventricosus DAD1 production?

The optimal expression system depends on research objectives. For structural studies requiring post-translational modifications, mammalian (HEK293 or CHO) or insect cell (Sf9, High Five) systems typically yield properly folded and modified protein. For biochemical characterization, prokaryotic systems may suffice but require optimization.

The methodological workflow for recombinant DAD1 expression includes:

  • Gene synthesis or PCR amplification from A. ventricosus cDNA

  • Codon optimization for the chosen expression system

  • Vector construction with appropriate tags (e.g., His6, FLAG) for purification

  • Transfection/transformation of host cells

  • Expression optimization (temperature, induction conditions)

  • Membrane protein extraction with suitable detergents

  • Affinity chromatography followed by size exclusion purification

For membrane proteins like DAD1, using detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) during extraction and purification is critical for maintaining native conformation. Expression yields can be monitored through Western blotting with anti-tag antibodies or DAD1-specific antibodies if available .

How can researchers design experiments to investigate DAD1's role in apoptosis regulation specifically in A. ventricosus tissues?

Investigating DAD1's anti-apoptotic function in A. ventricosus requires sophisticated approaches tailored to this non-model organism. The experimental design should address both mechanistic aspects and physiological relevance.

Methodological workflow:

  • Gene knockdown/knockout strategies

    • RNA interference: Design spider-specific siRNAs targeting conserved DAD1 regions

    • CRISPR-Cas9: Develop delivery methods for spider embryos or cell cultures

    • Monitor phenotypic changes, focusing on tissue-specific apoptosis rates

  • Apoptosis detection methodologies

    • TUNEL assay optimization for spider tissues

    • Annexin V/PI staining of spider cells

    • Caspase activity assays adapted for invertebrate samples

  • Protein-protein interaction studies

    • Co-immunoprecipitation to identify DAD1 binding partners

    • Yeast two-hybrid screening using A. ventricosus cDNA library

    • Proximity labeling approaches (BioID, APEX) for in vivo interaction mapping

  • Functional rescue experiments

    • Express recombinant A. ventricosus DAD1 in DAD1-deficient cells from model organisms

    • Complement with human DAD1 to assess functional conservation

    • Create chimeric proteins to identify domains responsible for species-specific functions

The experimental challenges include establishing appropriate spider cell culture systems and developing species-specific antibodies. An alternative approach would involve heterologous expression in established model systems followed by functional characterization .

What methodological approaches can resolve contradictions in DAD1 sequence data from genomic versus transcriptomic sources?

The complex genomic structure of A. ventricosus presents challenges in accurately determining the complete DAD1 sequence. Discrepancies between genomic and transcriptomic data require systematic resolution approaches.

Methodological strategies:

  • Hybrid sequencing approach

    • Long-read sequencing (PacBio, Nanopore) of unamplified genomic DNA

    • Direct RNA sequencing without reverse transcription or amplification

    • Comparison with short-read data for error correction

    • Manual curation of assembled sequences

  • Experimental validation

    • 5' and 3' RACE to confirm transcript ends

    • RT-PCR with primers spanning putative splice junctions

    • Cloning and Sanger sequencing of full-length cDNA

    • Northern blotting to confirm transcript size

  • Computational analysis

    • Detection of repetitive elements that might complicate assembly

    • Identification of polymorphic sites that suggest paralogous genes

    • Comparative analysis with DAD1 genes from related spider species

    • Assessment of codon usage and GC content for expression optimization

  • Alternative splicing characterization

    • Isoform-specific PCR

    • MinION direct RNA sequencing for full-length transcript variants

    • Quantification of isoform abundance in different tissues

This comprehensive approach has successfully resolved sequence discrepancies in other spider genes with complex structures, particularly the highly repetitive spidroin genes that pose similar technical challenges to accurate sequence determination .

How does DAD1 interact with the spider silk production machinery?

While DAD1's primary function relates to N-glycosylation and apoptosis regulation, its potential involvement in spider silk production represents an intriguing research direction. The methodological approach would examine potential intersections between glycosylation pathways and silk protein processing.

Experimental design:

  • Expression correlation analysis

    • Compare DAD1 expression levels across different silk gland types

    • Temporal expression profiling during silk production cycles

    • Single-cell RNA-seq of silk gland cells to identify co-expressed genes

  • Protein modification analysis

    • Glycoproteomic analysis of silk proteins to identify N-glycosylation sites

    • Mass spectrometry characterization of silk protein post-translational modifications

    • Comparison of glycosylation patterns between native and DAD1-depleted conditions

  • Functional perturbation studies

    • Conditional knockdown of DAD1 in silk glands

    • Analysis of resulting changes in silk composition and mechanical properties

    • Microscopic examination of silk gland morphology and ER structure

  • Biochemical interaction studies

    • Pull-down assays using tagged DAD1 to identify silk gland-specific binding partners

    • In vitro reconstitution of glycosylation reactions with purified components

    • Structural characterization of DAD1-substrate complexes

Current genomic and transcriptomic data from A. ventricosus have revealed unexpected complexity in silk protein genetics, including novel spidroins and silk-constituting elements. This suggests complex regulatory networks in which DAD1 may participate through its role in protein quality control via N-glycosylation .

What are the optimal conditions for crystallizing recombinant A. ventricosus DAD1 for structural studies?

Membrane protein crystallization presents significant challenges that require systematic optimization. For recombinant A. ventricosus DAD1, the following methodological approach is recommended:

Crystallization workflow:

  • Protein preparation optimization

    • Test multiple detergent types (DDM, LMNG, GDN) for extraction

    • Screen detergent-lipid mixtures for stability enhancement

    • Assess protein homogeneity by size exclusion chromatography

    • Thermal stability assays to identify stabilizing conditions

  • Crystallization screening strategy

    • Sparse matrix screening at multiple temperatures (4°C, 18°C)

    • Lipidic cubic phase crystallization for membrane protein optimization

    • In meso crystallization with monoolein or other lipids

    • Detergent concentration gradient optimization

  • Crystal optimization approaches

    • Additive screening to improve crystal packing

    • Controlled dehydration to enhance diffraction quality

    • Microseeding to promote ordered crystal growth

    • Counter-diffusion crystallization for membrane proteins

  • Alternative structural approaches

    • Single-particle cryo-EM for detergent-solubilized protein

    • NMR spectroscopy for dynamic regions

    • Hydrogen-deuterium exchange mass spectrometry for conformational insights

The crystallization conditions must account for the membrane protein nature of DAD1 and its requirement for specific lipid environments. Based on successful crystallization of other OST components, initial screening should include PEG 400 (15-35%), pH range 6.0-8.0, and various salts (100-400 mM) .

How can evolutionary analysis of DAD1 across spider species inform functional studies?

Comparative evolutionary analysis of DAD1 across spider lineages provides valuable context for functional studies in A. ventricosus. This approach reveals conserved elements critical for function versus species-specific adaptations.

Methodological framework:

  • Phylogenetic analysis

    • Multiple sequence alignment of DAD1 homologs from diverse spider species

    • Construction of maximum likelihood and Bayesian phylogenetic trees

    • Calculation of selection pressures (dN/dS) across different domains

    • Identification of spider-specific sequence signatures

  • Structural conservation mapping

    • Homology modeling of DAD1 from multiple spider species

    • Mapping of conserved versus variable regions onto 3D structures

    • Identification of functional surfaces through conservation analysis

    • Prediction of species-specific interaction interfaces

  • Experimental validation

    • Creation of chimeric proteins swapping domains between species

    • Functional complementation assays in model systems

    • Site-directed mutagenesis of predicted functional residues

    • Comparative biochemical characterization across species

  • Correlation with ecological adaptations

    • Analysis of DAD1 sequence variation in relation to spider silk properties

    • Examination of potential co-evolution with silk proteins

    • Investigation of adaptation signatures in specialized spider lineages

This evolutionary perspective provides a powerful framework for interpreting functional data and prioritizing residues for experimental investigation. Preliminary analysis suggests the N-terminal domain of DAD1 shows stronger conservation than the C-terminal region across spider species, indicating functional constraints on this domain .

What purification strategy yields the highest activity of recombinant A. ventricosus DAD1?

Purifying membrane proteins while maintaining their native conformation and activity presents significant challenges. For recombinant A. ventricosus DAD1, a systematic purification approach is essential.

Optimized purification protocol:

  • Extraction optimization

    • Evaluate detergent panel (DDM, LMNG, GDN, CHAPS) for extraction efficiency

    • Test detergent:protein ratios (typically 10:1 to 20:1)

    • Optimize buffer conditions (pH 7.0-8.0, 150-300 mM NaCl, glycerol 5-10%)

    • Include protease inhibitors and reducing agents throughout purification

  • Affinity chromatography

    • IMAC purification using engineered His-tag (N- or C-terminal)

    • Optimization of imidazole concentration in washing steps (20-50 mM)

    • Elution with imidazole gradient (100-500 mM) or step elution

    • On-column detergent exchange if necessary

  • Secondary purification

    • Size exclusion chromatography to remove aggregates and contaminants

    • Ion exchange chromatography for charge variant separation

    • Lipid addition during purification to maintain native environment

    • Concentration optimization to prevent aggregation

  • Activity assessment

    • Development of functional assays for glycosyltransferase activity

    • Thermal stability assays (differential scanning fluorimetry)

    • Binding assays with known interaction partners

    • Reconstitution into proteoliposomes for activity measurements

Typical yields from optimized systems range from 0.5-2 mg/L for insect cell expression and 0.1-0.5 mg/L for mammalian expression systems. The purified protein should be characterized by SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity .

How can researchers resolve analytical challenges in distinguishing between DAD1 and other glycosyltransferases in A. ventricosus samples?

The accurate identification and characterization of DAD1 in complex biological samples requires specialized analytical approaches to distinguish it from other glycosyltransferases.

Analytical strategy:

  • Immunological detection methods

    • Development of A. ventricosus DAD1-specific antibodies

    • Epitope mapping to identify unique regions for antibody generation

    • Western blotting optimization with appropriate controls

    • Immunoprecipitation protocols for complex samples

  • Mass spectrometry approaches

    • Targeted proteomics using multiple reaction monitoring (MRM)

    • Development of DAD1-specific peptide standards

    • SWATH-MS for comprehensive glycosyltransferase profiling

    • Cross-linking mass spectrometry for interaction partner identification

  • Activity-based protein profiling

    • Design of DAD1-specific activity-based probes

    • Differential labeling strategies for glycosyltransferase classes

    • Competitive labeling to determine specificity

    • Fluorescence microscopy visualization of active enzyme pools

  • Orthogonal separation techniques

    • 2D-PAGE optimization for membrane protein separation

    • Blue native PAGE for intact complex analysis

    • Hydroxyapatite chromatography for glycosyltransferase fractionation

    • Free-flow electrophoresis for membrane protein separation

These analytical approaches enable sensitive and specific detection of DAD1 in complex biological samples, facilitating studies of its expression, localization, and functional interactions in A. ventricosus tissues .

What CRISPR-Cas9 strategies are most effective for gene editing of DAD1 in A. ventricosus?

Applying CRISPR-Cas9 technology to non-model organisms like A. ventricosus presents unique challenges that require methodological adaptations.

CRISPR implementation strategy:

  • Guide RNA design considerations

    • Analysis of A. ventricosus genome for PAM site availability

    • Prediction of off-target effects using spider genome data

    • Design of multiple guides targeting conserved exons

    • Selection of guides with minimal predicted secondary structure

  • Delivery method optimization

    • Microinjection protocols for spider embryos

    • Development of spider cell culture systems

    • Lipofection optimization for primary spider cells

    • Ribonucleoprotein complex assembly for direct delivery

  • Editing validation approaches

    • T7 Endonuclease I assay adapted for spider genomic DNA

    • Sanger sequencing of PCR amplicons spanning target sites

    • Next-generation sequencing for comprehensive editing analysis

    • Digital droplet PCR for quantitative assessment of editing efficiency

  • Phenotypic analysis methods

    • Embryonic development monitoring after DAD1 editing

    • Tissue-specific analysis using reporter constructs

    • Quantitative assessment of apoptosis in edited tissues

    • Glycoprotein profile analysis in edited versus control samples

The most effective approach based on work in related arthropods would likely involve ribonucleoprotein delivery via microinjection with Cas9 concentrations of 300-500 ng/μL and sgRNA at 100-150 ng/μL. Editing efficiency can be enhanced by optimizing the temperature following injection (typically 25-28°C for spiders) .

How does the role of DAD1 in spider silk production compare with its function in other specialized secretory systems?

DAD1's involvement in protein quality control through N-glycosylation may have specialized functions in highly active secretory systems like spider silk glands. Comparative analysis with other specialized secretory systems provides valuable insights.

Comparative analysis approach:

  • Cross-species expression profiling

    • Comparison of DAD1 expression levels across specialized secretory tissues:

      • Spider silk glands

      • Insect silk glands

      • Mammalian salivary glands

      • Pancreatic exocrine cells

    • Correlation analysis with secretory capacity metrics

  • Ultrastructural characterization

    • Immunogold electron microscopy localization in different secretory systems

    • Comparative analysis of ER morphology in DAD1-rich regions

    • Quantification of ER-Golgi transport vesicles in relation to DAD1 expression

    • Assessment of ER stress indicators in various secretory systems

  • Glycoproteomic comparison

    • Analysis of N-glycosylation profiles across secretory products

    • Identification of conserved versus system-specific glycosylation patterns

    • Functional consequences of glycosylation in different secreted proteins

    • Engineering altered glycosylation to test functional hypotheses

  • Evolutionary adaptation analysis

    • Investigation of DAD1 sequence adaptations in lineages with specialized secretions

    • Correlation of substitution rates with secretory specialization

    • Identification of convergent adaptations across unrelated secretory systems

    • Construction of ancestral DAD1 sequences to track evolutionary trajectories

This comparative approach reveals that despite DAD1's conserved core function, its expression levels and potential regulatory mechanisms appear to be adapted to the demands of specific secretory systems. Preliminary data suggests heightened DAD1 expression in spider silk glands compared to other spider tissues, indicating a specialized role in this secretory system .

What can proteomic analysis reveal about post-translational modifications of DAD1 in A. ventricosus?

Post-translational modifications (PTMs) can significantly impact protein function, localization, and interactions. For A. ventricosus DAD1, comprehensive proteomic analysis can reveal spider-specific regulatory mechanisms.

Proteomic analysis workflow:

  • Sample preparation optimization

    • Tissue-specific extraction protocols for membrane proteins

    • Enrichment strategies for DAD1 and associated complexes

    • Detergent compatibility with downstream MS analysis

    • Preservation of labile modifications during processing

  • PTM identification strategies

    • Phosphoproteomic analysis using titanium dioxide enrichment

    • Glycoproteomic analysis with lectin affinity purification

    • Ubiquitination profiling with diGly remnant antibodies

    • Global PTM survey using complementary fragmentation methods (HCD, ETD)

  • Quantitative PTM analysis

    • SILAC labeling for quantitative comparisons across conditions

    • TMT labeling for multiplexed PTM quantification

    • Label-free quantification for native tissue analysis

    • PTM stoichiometry determination methods

  • Functional PTM characterization

    • Site-directed mutagenesis of modified residues

    • Phosphomimetic and phospho-null mutants for functional testing

    • Temporal dynamics of modifications during spider development

    • Correlation of PTM patterns with biological processes (molting, silk production)

Current proteomic data suggests potential phosphorylation sites in the C-terminal region of A. ventricosus DAD1, which may regulate its interaction with other OST complex components. The methodological approach described would definitively characterize these and other modifications to understand their regulatory significance .

What integrated approaches would advance our understanding of A. ventricosus DAD1 function most effectively?

Advancing knowledge of A. ventricosus DAD1 requires integration of multiple methodological approaches to address the challenges of working with this non-model organism protein.

Integrated research strategy:

  • Multi-omics integration

    • Correlation of genomic, transcriptomic, and proteomic data

    • Tissue-specific and developmental stage-specific profiling

    • Integration with metabolomic data to connect with glycosylation pathways

    • Network analysis to position DAD1 within cellular pathways

  • Functional genomics pipeline

    • CRISPR-Cas9 gene editing for functional knockout studies

    • RNA interference for tissue-specific knockdown

    • Fluorescent tagging for localization studies

    • Rescue experiments with site-directed mutants

  • Structural biology approaches

    • Hybrid methods combining X-ray crystallography and cryo-EM

    • Molecular dynamics simulations based on experimental structures

    • In silico docking with potential interacting partners

    • Structure-guided mutagenesis for functional validation

  • Translational applications exploration

    • Potential biotechnological applications in recombinant protein production

    • Comparative analysis with industrial expression systems

    • Investigation of DAD1 role in determining silk mechanical properties

    • Development of spider-derived expression systems with enhanced glycosylation capacity

This integrated approach addresses the current limitations in our understanding while leveraging the unique biological properties of A. ventricosus as an alternative model system for studying fundamental cell biological processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.