Recombinant Arbacia lixula Cytochrome c oxidase subunit 3 (COIII)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant COIII is typically expressed in E. coli with affinity tags (e.g., His-tag) for purification. Commercial sources (e.g., AmericanSci, Creative BioMart) provide the protein in Tris-based buffers with 50% glycerol, optimized for stability at -20°C . Key production parameters include:

ParameterSpecification
Expression HostE. coli K12
Purity>90% (SDS-PAGE)
StorageLyophilized or -80°C aliquots
ApplicationsEnzyme assays, antibody production

Codon optimization for E. coli enhances yield, though challenges like inclusion body formation require further refinement .

Functional Insights

COIII is a non-catalytic subunit of cytochrome c oxidase (Complex IV). Key findings:

  • No Proton Translocation Role: Mutagenesis of conserved residues (e.g., E98, D259) in bacterial homologs showed no impact on proton pumping, contradicting earlier hypotheses .

  • Electron Transport Stability: COIII stabilizes redox centers (heme A3, CuB) and maintains structural integrity during electron transfer .

  • Evolutionary Conservation: Despite low sequence variability in first/second codon positions, third positions reflect directional mutational pressures .

Applications in Research

  • Anti-Aging Therapeutics: A. lixula-derived peptides, including COIII fragments, show in silico binding affinity (-9.07 to -10.57 kcal/mol) against skin-aging enzymes (tyrosinase, elastase) .

  • Recombinant Plasmid Development: The COIII gene has been inserted into pSB1C3 plasmids (~2,164 bp) for scalable production, confirmed by virtual electrophoresis .

  • Disease Modeling: Human MT-CO3 mutations are linked to Leber hereditary optic neuropathy, making recombinant COIII a tool for studying mitochondrial disorders .

Limitations and Future Directions

  • In Silico Bias: Current anti-aging data rely on computational models lacking in vitro validation .

  • Expression Challenges: Low solubility and inclusion body formation in E. coli necessitate optimized folding protocols .

  • Functional Gaps: The exact role of COIII in stabilizing Complex IV remains unresolved, warranting cryo-EM studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development of that tag.
Synonyms
COIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Arbacia lixula (Black urchin) (Echinus lixula)
Target Names
COIII
Target Protein Sequence
AGNRTEAVQALFLTVALGIYFTILQAWEYYDSPFTIADSVYGSTFFVATGFHGLHVINST TFLLVCLFRLINFHFSAHHHFGFEAAAWYWDFVDVVVAFSLYMHIWWGS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COIII) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase is the enzyme responsible for catalyzing the reduction of oxygen to water in the respiratory chain. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site located in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Arbacia lixula Cytochrome c oxidase subunit 3 (COIII) and what is its significance in research?

Arbacia lixula Cytochrome c oxidase subunit 3 (COIII) is a mitochondrial protein component derived from the black sea urchin (Arbacia lixula, also known as Echinus lixula). The full-length protein consists of 109 amino acids and functions as part of the cytochrome c oxidase complex in the electron transport chain . This protein has significant research value as an evolutionary marker due to its strong conservation across sea urchin species, while simultaneously exhibiting species-specific variations that make it useful for population genetics studies . The identification of specific functional motifs, such as the N R T glycosylation site, has revealed new aspects of this protein's biological role .

How are recombinant forms of Arbacia lixula COIII typically produced for research applications?

Recombinant Arbacia lixula COIII is typically produced in Escherichia coli expression systems with an N-terminal histidine (His) tag to facilitate purification . The expression construct contains the coding sequence for the full-length protein (amino acids 1-109). After bacterial expression, the protein is purified to >90% purity as determined by SDS-PAGE . The final product is commonly prepared as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 for stability during storage . Reconstitution protocols typically involve dissolving the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (5-50%) for preparations intended for long-term storage at -20°C/-80°C .

How conserved is the COIII gene across sea urchin species and what does this reveal about its evolution?

The COIII gene shows remarkable conservation across sea urchin species, particularly at the first and second codon positions. Comparative analysis reveals that the evolutionary dynamics of these positions are so slow that they don't allow quantitative measurement of genetic distances, demonstrating the critical functional importance of COIII . This strong conservation suggests that COIII plays a vital role in metabolism that cannot tolerate significant variation.

What population genetic patterns have been observed in Arbacia lixula and how does COIII contribute to understanding these patterns?

Population genomic studies of Arbacia lixula have revealed significant genetic structure between western and eastern Mediterranean populations . Analysis of genetic markers shows:

RegionMean FSTHeterozygosity (Ho)Expected Heterozygosity (He)FIS Values
Western Mediterranean0.00050.379 ± 0.0020.441 ± 0.0020.141 ± 0.006
Eastern Mediterranean-0.00010.379 ± 0.0020.441 ± 0.0020.141 ± 0.006
Between regions0.00464---

All populations show a deficit of heterozygotes, with positive and significant FIS values . COIII, as a conserved mitochondrial marker, contributes to understanding population structure by providing insights into maternal lineage inheritance patterns that complement nuclear markers. When combined with genome-wide markers, COIII can help distinguish between neutral evolutionary processes and adaptive divergence in response to environmental factors like salinity, which has been identified as a significant driver of genetic differentiation in this species .

How do environmental factors influence the evolution and expression of COIII in Arbacia lixula populations?

Environmental factors, particularly salinity, have been identified as significant drivers of genetic differentiation in Arbacia lixula populations . Statistical analyses using Redundancy Analysis (RDA) and partial Mantel tests have shown that salinity variables have a much stronger correlation with genetic structure than temperature variables after controlling for geographic distance .

Salinity measures (mean, maximal, and minimal) showed r² coefficients above 0.78 when fitted to ordination based on genetic distances . This suggests that COIII and other genes in Arbacia lixula may have adapted to different salinity regimes across the Mediterranean, potentially through modifications that affect protein function or expression in response to osmotic stress. These findings indicate that while temperature has known effects on biological and reproductive parameters of this species, salinity should be considered as an important driver of adaptation and genetic differentiation .

What are the optimal conditions for expressing and purifying recombinant Arbacia lixula COIII?

Optimal expression and purification of recombinant Arbacia lixula COIII involves several critical considerations:

Expression system:

  • Host: E. coli (commonly BL21(DE3) strains)

  • Vector: Containing N-terminal His-tag for affinity purification

  • Induction: IPTG-inducible system with optimization of concentration and temperature

  • Growth conditions: Lower temperatures (16-25°C) often improve soluble protein yield

Purification protocol:

  • Affinity chromatography using Ni-NTA resin

  • Buffer conditions: Tris/PBS-based buffer, pH 8.0

  • Elution with imidazole gradient

  • Secondary purification steps as needed (size exclusion, ion exchange)

  • Quality control by SDS-PAGE to confirm >90% purity

Storage considerations:

  • Lyophilization in Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Alternative: Solution with 5-50% glycerol (50% recommended)

  • Storage temperature: -20°C/-80°C for long-term stability

  • Working solutions: 4°C for up to one week

  • Avoidance of repeated freeze-thaw cycles

These conditions should be optimized for each specific experimental setup to maximize yield and maintain protein functionality.

What analytical methods are most effective for assessing the quality and functionality of purified Arbacia lixula COIII?

A comprehensive quality assessment strategy for purified recombinant Arbacia lixula COIII should include:

Purity assessment:

  • SDS-PAGE with appropriate staining (>90% purity standard)

  • Western blotting using anti-His antibodies or COIII-specific antibodies

  • Mass spectrometry to confirm identity and detect modifications

Structural integrity:

  • Circular dichroism spectroscopy to assess secondary structure

  • Fluorescence spectroscopy for tertiary structure evaluation

  • Dynamic light scattering to detect aggregation

Functional characterization:

  • Electron transport activity assays

  • Oxygen consumption measurements

  • Binding assays with known interaction partners

Glycosylation analysis:

  • Specific assays to detect and characterize the N R T glycosylation site

  • Comparative analysis with native protein to verify post-translational modifications

These analytical methods collectively provide a comprehensive assessment of protein quality, ensuring that the recombinant COIII meets the standards required for reliable experimental applications.

What challenges might researchers encounter when working with Arbacia lixula COIII and how can these be addressed?

Researchers working with Arbacia lixula COIII may encounter several challenges:

Challenge 1: Protein solubility issues

  • Solution: Use of solubility-enhancing fusion partners, detergents, or membrane-mimicking environments

  • Alternative: Lower expression temperatures and reduced inducer concentrations

  • Approach: Co-expression with molecular chaperones

Challenge 2: Maintaining functional conformation

  • Solution: Careful buffer optimization during purification and storage

  • Approach: Inclusion of stabilizing agents like trehalose (6%) in storage buffers

  • Method: Validation of structural integrity through spectroscopic techniques

Challenge 3: Reconstitution difficulties

  • Solution: Gradual addition of reconstitution buffer to lyophilized protein

  • Protocol: Brief centrifugation of vial prior to opening

  • Approach: Reconstitution to moderate concentration (0.1-1.0 mg/mL)

  • Additive: Glycerol (5-50%) for preparations intended for storage

Challenge 4: Species-specific variations affecting experimental design

  • Solution: Careful consideration of the source population given western-eastern Mediterranean genetic differences

  • Approach: Sequence verification before experimental use

  • Strategy: Use of multiple biological replicates to account for natural variation

Addressing these challenges requires careful experimental planning and implementation of appropriate technical solutions based on protein characteristics.

How can recombinant Arbacia lixula COIII be used in evolutionary biology studies?

Recombinant Arbacia lixula COIII serves as a valuable tool in evolutionary biology through multiple applications:

Phylogenetic analysis:

  • Comparison with COIII from other species to establish evolutionary relationships

  • Assessment of conservation patterns to determine selective pressures

  • Analysis of codon usage and nucleotide substitution rates

Population genetics:

  • Investigation of genetic structure within Mediterranean populations

  • Correlation of genetic patterns with environmental variables like salinity

  • Study of gene flow between western and eastern Mediterranean populations

Molecular evolution experiments:

  • Site-directed mutagenesis to recreate ancestral sequences

  • Functional characterization of evolutionary intermediates

  • Comparison of kinetic properties across phylogenetic distances

The strong conservation of COIII, particularly at first and second codon positions, makes it valuable for deep phylogenetic analyses , while population-level studies can leverage both conserved and variable regions to understand recent evolutionary dynamics and local adaptation .

What insights can functional studies of Arbacia lixula COIII provide about adaptation to environmental factors?

Functional studies of Arbacia lixula COIII can provide significant insights into adaptation to environmental factors, particularly salinity, which has been identified as a key driver of genetic differentiation :

Experimental approaches:

  • Comparative biochemistry of COIII from different populations

  • Measurement of enzyme kinetics under varying salinity conditions

  • Site-directed mutagenesis of residues that differ between populations

  • Expression studies in response to environmental stressors

Research questions that can be addressed:

  • How does salinity affect COIII structure and function?

  • What molecular mechanisms underlie adaptation to different salinity regimes?

  • How do post-translational modifications (particularly glycosylation at the N R T motif) contribute to environmental adaptation?

  • Are there tradeoffs between adaptation to different environmental factors?

These studies can help explain the observed genetic differentiation between western and eastern Mediterranean populations and provide insights into how this species might respond to changing environmental conditions in marine ecosystems.

How can site-directed mutagenesis of Arbacia lixula COIII advance understanding of structure-function relationships?

Site-directed mutagenesis of Arbacia lixula COIII presents powerful opportunities to investigate structure-function relationships:

Target regions for mutagenesis:

  • The N R T glycosylation motif to determine its functional significance

  • Conserved residues identified through multi-species alignment

  • Positions that differ between western and eastern Mediterranean populations

  • Residues at proposed protein-protein interaction interfaces

Experimental approaches:

  • Alanine scanning mutagenesis to map functional domains

  • Conservative vs. non-conservative substitutions to determine residue properties

  • Creation of chimeric proteins with sequences from other species

  • Introduction of mammalian-like glycosylation sites to study functional convergence

Functional assessment methods:

  • Spectroscopic analysis to detect structural changes

  • Activity assays to measure effects on electron transport

  • Protein stability measurements under varying conditions

  • Assembly studies with other cytochrome oxidase components

These mutagenesis studies can reveal residues critical for catalytic activity, complex assembly, and adaptation to environmental conditions, advancing understanding of both basic mitochondrial biology and evolutionary adaptation in marine invertebrates.

How might the glycosylation site (N R T motif) in Arbacia lixula COIII affect protein function compared to mammalian COIII?

The identification of the N R T glycosylation motif in Arbacia lixula COIII represents a significant finding with potential functional implications . Comparative research approaches to understand its significance include:

Structural analysis:

  • Modeling the position of the glycosylation site in the tertiary structure

  • Comparing its location with the differently positioned mammalian glycosylation site

  • Assessing potential interactions with other subunits of the cytochrome c oxidase complex

Functional comparisons:

  • Enzymatic removal of glycans to determine effects on activity

  • Site-directed mutagenesis to prevent glycosylation

  • Creation of recombinant variants with mammalian-like glycosylation patterns

  • Measurement of electron transport kinetics with different glycoforms

Evolutionary perspective:

  • Analysis of glycosylation sites across marine invertebrate lineages

  • Correlation of glycosylation patterns with environmental adaptations

  • Investigation of convergent evolution in post-translational modifications

This research direction could reveal how different glycosylation patterns contribute to the functional adaptation of cytochrome c oxidase across diverse lineages and environments, potentially explaining why different positions were selected for this modification in mammals versus sea urchins .

What experimental designs can best evaluate the impact of salinity on Arbacia lixula COIII function?

Given the significant correlation between salinity and Arbacia lixula genetic structure , experimental designs to evaluate salinity effects on COIII function should include:

Laboratory experiments:

  • Exposure of intact sea urchins to controlled salinity gradients

  • Isolation of mitochondria from treated animals to assess COIII expression and function

  • Measurement of oxygen consumption rates under different salinity conditions

  • Analysis of COIII post-translational modifications in response to salinity stress

Molecular approaches:

  • Expression of recombinant COIII variants from eastern (higher salinity) and western (lower salinity) Mediterranean populations

  • Comparative enzyme kinetics under varying salt concentrations

  • Structural studies to identify salt-sensitive regions of the protein

  • Site-directed mutagenesis of residues that differ between populations from different salinity regimes

Field-based studies:

  • Sampling along natural salinity gradients in the Mediterranean

  • Correlation of COIII sequence/expression variations with environmental parameters

  • Transplant experiments between locations with different salinity regimes

  • Long-term monitoring to detect selection events following salinity changes

These experimental approaches can help determine whether the correlation between salinity and genetic structure has functional significance for COIII activity and mitochondrial function, potentially explaining the observed population differentiation between western and eastern Mediterranean populations .

How can high-throughput approaches advance our understanding of COIII evolution across sea urchin species?

High-throughput approaches can significantly advance understanding of COIII evolution across sea urchin species through:

Genomic techniques:

  • Whole genome sequencing of multiple sea urchin species for comparative analysis

  • RNA-Seq to quantify COIII expression across tissues, developmental stages, and environmental conditions

  • ChIP-Seq to identify regulatory elements controlling COIII expression

  • ATAC-Seq to assess chromatin accessibility around the COIII gene

Proteomic approaches:

  • Mass spectrometry-based identification of post-translational modifications

  • Protein-protein interaction mapping using proximity labeling techniques

  • Structural proteomics to determine conformation under different conditions

  • Comparative analysis of the entire cytochrome c oxidase complex across species

Bioinformatic integration:

  • Phylogenetic analysis incorporating data from multiple sea urchin species

  • Molecular evolution models to detect signatures of selection

  • Structural modeling to map sequence variations onto 3D protein structure

  • Network analysis to identify co-evolving residues within COIII and between subunits

These high-throughput approaches can provide a systems-level understanding of COIII evolution, moving beyond the three-species comparison initially reported to a comprehensive evolutionary model that accounts for both neutral and adaptive processes across the entire sea urchin phylogeny.

How might climate change affect Arbacia lixula COIII function and what research approaches can address this question?

Climate change, particularly ocean warming and changing salinity patterns, may significantly impact Arbacia lixula COIII function. Research approaches to address this question include:

Experimental climate change models:

  • Exposure of sea urchins to projected future temperature and salinity conditions

  • Time-course analysis of COIII expression, modification, and activity

  • Multi-generational studies to assess adaptive potential

  • Field studies along natural climate gradients as space-for-time substitutions

Molecular vulnerability assessment:

  • Thermal stability analysis of recombinant COIII from different populations

  • Functional assays under combined stressors (temperature, pH, salinity)

  • Comparison of stress responses between western and eastern Mediterranean populations

  • Identification of potential compensatory mechanisms at genomic and proteomic levels

Predictive modeling:

  • Integration of molecular data with climate projections

  • Population genetic simulations incorporating selection on COIII

  • Mechanistic models linking COIII function to higher-level physiological processes

  • Species distribution models incorporating molecular adaptation capacity

These research directions can help predict how this keystone species might respond to changing Mediterranean conditions, with implications for rocky shore ecosystem functioning and management.

What interdisciplinary approaches could advance our understanding of the relationship between COIII genetics and ecological function?

Advancing understanding of the relationship between COIII genetics and ecological function requires interdisciplinary approaches:

Ecological genetics:

  • Field experiments correlating COIII variants with ecological performance metrics

  • Common garden experiments with populations from different environments

  • Quantification of selection coefficients for COIII variants in natural settings

  • Assessment of COIII variation effects on population dynamics and community interactions

Functional genomics integration:

  • CRISPR-Cas9 modification of COIII in model species for functional validation

  • Transcriptomic profiling to identify genes co-regulated with COIII

  • Metabolomic analysis to link COIII variation to energy metabolism differences

  • Integration with population genomic data from western and eastern Mediterranean

Biogeochemical cycling connections:

  • Measurement of metabolic rates linked to different COIII variants

  • Assessment of carbon flux variations associated with COIII functional differences

  • Integration of molecular function with ecosystem-level processes

  • Modeling of population-level metabolic impacts on local marine chemistry

These interdisciplinary approaches can bridge the gap between molecular evolution, physiological function, and ecological processes, providing a comprehensive understanding of how variation in this important mitochondrial protein contributes to ecosystem functioning in changing marine environments.

How can synthetic biology approaches utilizing Arbacia lixula COIII advance both basic science and biotechnological applications?

Synthetic biology approaches utilizing Arbacia lixula COIII offer promising avenues for both fundamental research and applied biotechnology:

Basic science applications:

  • Creation of minimal synthetic electron transport chains to study fundamental principles

  • Design of chimeric proteins incorporating domains from different species

  • Development of COIII-based biosensors for environmental monitoring

  • Engineering of reporter systems to visualize mitochondrial function in vivo

Biotechnological innovations:

  • Development of robust biocatalysts based on extremophile-adapted COIII properties

  • Creation of mitochondrial disease models using engineered COIII variants

  • Design of environmental biosensors for salinity and pollutant detection

  • Production of optimized energy-generating systems for bioelectronics

Methodological advances:

  • Directed evolution platforms to generate COIII variants with novel properties

  • Cell-free expression systems for rapid production and testing

  • Microfluidic approaches for high-throughput functional screening

  • Computational design tools specific for mitochondrial membrane proteins

These synthetic biology approaches can both deepen our understanding of fundamental biological principles governing electron transport and mitochondrial function while simultaneously developing novel biotechnologies based on the unique properties of sea urchin COIII adaptations to marine environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.