Recombinant Arbacia lixula NADH-ubiquinone oxidoreductase chain 1 (ND1)

Shipped with Ice Packs
In Stock

Description

Introduction to NADH-Ubiquinone Oxidoreductase Chain 1 (ND1)

NADH-ubiquinone oxidoreductase chain 1 (ND1) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase, also known as Complex I. This enzyme plays a crucial role in the electron transport chain, facilitating the transfer of electrons from NADH to coenzyme Q10 (CoQ10) and translocating protons across the inner mitochondrial membrane, which helps generate ATP . While specific information on "Recombinant Arbacia lixula NADH-ubiquinone oxidoreductase chain 1 (ND1)" is limited, understanding the general function and structure of ND1 can provide insights into its potential recombinant form.

Function of NADH-Ubiquinone Oxidoreductase Chain 1 (ND1)

ND1 is part of Complex I, which is the first enzyme in the mitochondrial electron transport chain. It catalyzes the reaction:

NADH+H++CoQ+4Hin+NAD++CoQH2+4Hout+\text{NADH} + \text{H}^+ + \text{CoQ} + 4\text{H}^+_{\text{in}} \rightarrow \text{NAD}^+ + \text{CoQH}_2 + 4\text{H}^+_{\text{out}}

This process involves the transfer of electrons from NADH to CoQ10, resulting in the translocation of four protons across the mitochondrial membrane, contributing to the proton gradient necessary for ATP synthesis .

Structure and Mechanism

Complex I, including the ND1 subunit, consists of a hydrophilic domain where redox reactions occur and a hydrophobic domain involved in proton translocation. The electron transfer pathway involves flavin mononucleotide (FMN) and a series of iron-sulfur clusters, culminating in the reduction of CoQ10 to ubiquinol .

Potential of Recombinant ND1 from Arbacia lixula

While there is no specific literature on "Recombinant Arbacia lixula NADH-ubiquinone oxidoreductase chain 1 (ND1)", research on peptides from Arbacia lixula suggests potential applications in biotechnology and medicine. For instance, peptides from A. lixula have been explored for anti-aging and anticancer properties . The concept of recombinant ND1 could involve using genetic engineering to express this protein in a system that allows for its study or application in bioenergetic research or therapeutic development.

Research Findings and Potential Applications

Given the lack of direct information on recombinant ND1 from Arbacia lixula, potential applications would likely align with those of Complex I in general, such as understanding mitochondrial function and dysfunction in diseases. Research on Complex I has highlighted its role in neurodegenerative diseases and metabolic disorders .

Table: Potential Applications of Recombinant ND1

Application AreaDescription
Mitochondrial ResearchStudying mitochondrial function and dysfunction in diseases.
Therapeutic DevelopmentPotential use in developing treatments for neurodegenerative diseases and metabolic disorders.
BiotechnologyExpression systems for studying protein structure and function.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ND1; NADH-ubiquinone oxidoreductase chain 1; NADH dehydrogenase subunit 1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Arbacia lixula (Black urchin) (Echinus lixula)
Target Names
ND1
Target Protein Sequence
MYAYIFAFFELITFLVPVLLAVAFLTLVERKVLGYMQFRKGPNVVGLTDFCNLFADGLKL FIKETVKPSSASPYLFFASPVLFLTLALLLWNFMPVTSPALDLQLSLLLVLGLSSLSVYA ILGSG
Uniprot No.

Target Background

Function

Recombinant Arbacia lixula NADH-ubiquinone oxidoreductase chain 1 (ND1): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be its immediate electron acceptor.

Protein Families
Complex I subunit 1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.