Recombinant Arbacia punctulata Bindin

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Bindin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
248-480
Protein Length
Full Length of Mature Protein
Species
Arbacia punctulata (Punctuate sea urchin)
Target Protein Sequence
YAQGAGGMQGGYGYPQAGGAQYGGQPVQGYMNQGPPMGQRPAAAGPAGGFGAPQGQPPVG QPIGEAAGGGEFLGEPGVGGESEFAEYSSSIGEGETINAEVMEKIKAVLGATKIDLPVDI NDPYDLGLLLRHLRHHSNLLANIGDPEVRNQVLTAMQEEEEEEEQDAANGVRDNVLNNLN EGPGAGAVAGAAMAAGMPPYPGGAQGGMRVGGQPQNPMGGNAYNPMTGYRQQG
Uniprot No.

Target Background

Function

Species-Specific Function: Recombinant Arbacia punctulata Bindin is a sea urchin sperm protein essential for sperm-egg adhesion during fertilization. Following the acrosome reaction, Bindin coats the acrosomal process, binding to sulfated, fucose-containing polysaccharides on the egg's vitelline layer receptor proteoglycans, which cover the egg plasma membrane.

Protein Families
Bindin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome membrane; Single-pass membrane protein.

Q&A

What is Arbacia punctulata bindin and what is its biological function?

Arbacia punctulata bindin is the major protein component of the acrosome granule found in sea urchin sperm. It plays a crucial role in fertilization by mediating species-specific adhesion of sperm to the egg surface. When isolated from both A. punctulata and other sea urchin species like Strongylocentrotus purpuratus, bindin demonstrates a distinct adhesive preference for eggs of the same species, though some cross-species reactivity does occur . This protein represents one of the key molecular components responsible for species-specific gamete recognition and binding, making it essential for successful fertilization in sea urchins.

Why is A. punctulata used as a model organism in fertilization research?

Arbacia punctulata offers several advantages as a research model:

  • Abundant gamete production: Female urchins release up to several million large, transparent eggs, providing plentiful experimental material .

  • External fertilization: The fertilization process occurs externally, making it easily observable and manipulable .

  • Large gamete size: The eggs are large and divide synchronously and rapidly, facilitating observation and sampling .

  • Historical research value: Sea urchins have served as experimental models for over a century, establishing a rich foundation of comparative data .

  • Contributions to basic science: Studies using A. punctulata have helped develop understanding of cell-mediated immune responses and have been instrumental in elucidating fertilization processes, cell division mechanisms, cell-cycle regulation, and embryonic development .

How does recombinant bindin differ from naturally occurring bindin?

Recombinant bindin is produced through genetic engineering techniques, typically involving the cloning of bindin cDNA into expression vectors for production in laboratory systems. While the primary sequence remains identical to native bindin, several differences may exist:

  • Post-translational modifications may differ depending on the expression system used

  • Structural conformation might vary slightly due to differences in folding environments

  • Functional activity can be affected by purification methods and storage conditions

  • Recombinant versions may lack associated cofactors present in natural contexts

When working with recombinant bindin, researchers should validate that the protein maintains the species-specific binding properties observed in naturally occurring bindin, particularly the preferential adhesion to eggs from the same species .

What expression systems are most effective for producing functional recombinant A. punctulata bindin?

When selecting an expression system for recombinant A. punctulata bindin production, researchers should consider several factors:

Expression SystemAdvantagesLimitationsConsiderations for Bindin
E. coliHigh yield, low cost, rapid expressionLimited post-translational modifications, inclusion body formationMay require refolding protocols due to the transmembrane segment (residues 431-451)
Yeast (S. cerevisiae, P. pastoris)Eukaryotic folding, moderate yieldsGlycosylation patterns differ from nativeBetter for maintaining structural integrity of the conserved 42-amino acid domain
Insect cellsComplex protein folding, post-translational modificationsHigher cost, longer production timePreferred for functional studies requiring authentic conformation
Mammalian cellsMost authentic post-translational modificationsHighest cost, lower yieldsBest for studies of bindin-receptor interactions and species-specificity

For functional studies, insect cell systems often provide the best balance between yield and proper folding, particularly important for maintaining the functional properties of the conserved central domain and the unique transmembrane segment that distinguishes A. punctulata bindin .

What purification strategies help maintain the functional integrity of recombinant bindin?

Purifying recombinant A. punctulata bindin while preserving its functional properties requires careful consideration:

  • Initial extraction: Use gentle detergents (like CHAPS or DDM) that preserve membrane protein structure, essential for maintaining the integrity of the transmembrane segment (residues 431-451) .

  • Chromatography sequence:

    • Affinity chromatography (using His-tags or GST-fusion constructs)

    • Ion exchange chromatography based on bindin's isoelectric point

    • Size exclusion chromatography to separate monomeric from aggregated forms

  • Critical considerations:

    • Maintain physiological pH (7.4-8.0) throughout purification

    • Include stabilizing agents like glycerol (10-15%)

    • Use protease inhibitors to prevent degradation

    • Consider including phospholipids in buffers to stabilize the transmembrane domain

    • Perform functional assays at each purification step to monitor activity retention

This approach helps preserve both the species-specific binding properties and the unique multilamellar structure formation capability that distinguishes A. punctulata bindin from other sea urchin bindins .

How can I design functional assays to measure species-specific binding activity of recombinant bindin?

To evaluate whether your recombinant A. punctulata bindin maintains proper functionality, consider these assay approaches:

  • Egg binding assays:

    • Obtain fresh gametes from A. punctulata and comparative species (e.g., S. purpuratus)

    • Quantify binding of labeled recombinant bindin to eggs from both species

    • Compare binding ratios to establish species-specificity index

    • Positive control: Use native bindin extracted from A. punctulata sperm

  • Competitive inhibition assays:

    • Pre-incubate eggs with increasing concentrations of recombinant bindin

    • Add sperm and measure fertilization rates

    • Calculate IC50 values for species-specific vs. cross-species inhibition

    • This approach can validate both functionality and specificity simultaneously

  • Liposome fusion assays:

    • Create fluorescently labeled liposomes with egg receptor proteins

    • Measure fusion rates when exposed to recombinant bindin

    • This specifically tests the putative membrane fusion activity associated with the transmembrane segment unique to A. punctulata bindin

Data should be analyzed comparing bindin activity across species to confirm the expected preference for A. punctulata eggs while still showing the significant cross-species reactivity documented in previous studies .

How can recombinant A. punctulata bindin be used to study evolutionary patterns in fertilization proteins?

Recombinant bindin provides a powerful tool for evolutionary studies:

  • Comparative sequence analysis: By comparing the conserved 42-amino acid domain with the more divergent flanking regions in recombinant bindins from different species, researchers can identify patterns of selection pressure. The high conservation of the central domain suggests functional constraints, while the variability in flanking regions likely reflects species-specific adaptations .

  • Domain swapping experiments: Researchers can create chimeric proteins with domains from different species to identify which regions are responsible for species-specificity. This is particularly valuable for investigating the role of the unique transmembrane segment (residues 431-451) found in A. punctulata but absent in S. purpuratus bindin .

  • Molecular clock analyses: Using recombinant bindins from related species with known divergence times, researchers can estimate the rate of evolutionary change in different protein domains, providing insights into selective pressures.

  • Receptor co-evolution studies: By examining how egg receptors have co-evolved with bindin across species, researchers can better understand the molecular basis of reproductive isolation and speciation mechanisms in marine invertebrates.

These approaches can reveal how reproductive proteins evolve to maintain species barriers while preserving essential fertilization functions, with implications for understanding speciation mechanisms more broadly .

What are the challenges in creating functional mutants of the conserved 42-amino acid domain?

The highly conserved 42-amino acid domain in the central region of mature A. punctulata bindin presents specific challenges for mutation studies:

  • Structural integrity: Mutations may disrupt the protein's three-dimensional structure, leading to misfolding and loss of function. Even conservative substitutions can sometimes dramatically alter protein conformation.

  • Functional redundancy: The conserved domain likely contains redundant functional elements, making single mutations insufficient to observe phenotypic changes. Researchers should consider:

    • Alanine scanning across the entire domain

    • Multiple simultaneous mutations

    • Domain truncation studies

  • Expression challenges: Mutations in the conserved domain often reduce expression efficiency or increase protein aggregation, requiring optimization of:

    • Codon usage for the expression system

    • Induction conditions (temperature, inducer concentration)

    • Solubilization strategies

  • Functional assessment: Distinguishing between mutations that affect specific binding versus those that cause general protein dysfunction requires:

    • Circular dichroism to confirm proper folding

    • Comparative binding assays with multiple species' eggs

    • Controls using wild-type recombinant protein produced under identical conditions

When facing unexpected results, researchers should systematically investigate whether contradictory data reflects genuine biological phenomena or technical artifacts in the mutation design or protein production process .

How does the transmembrane segment (residues 431-451) contribute to the multilamellar structure formation of A. punctulata bindin?

The unique transmembrane segment in A. punctulata bindin enables its distinctive ability to form multilamellar structures resembling lipid bilayers. This property, absent in other sea urchin bindins like S. purpuratus, has significant functional implications:

  • Structural characteristics:

    • Hydrophobicity analysis reveals an amphipathic helix with one highly hydrophobic face

    • The segment contains periodic glycine residues that may provide flexibility

    • Molecular dynamics simulations suggest it preferentially inserts at a ~45° angle in lipid bilayers

  • Functional hypothesis:

    • The transmembrane segment may facilitate membrane fusion during fertilization

    • Its structural similarities to viral fusion peptides suggest a conserved mechanism

    • The multilamellar structures may represent intermediate states in the membrane fusion process

  • Experimental approaches to study this property:

    • Electron microscopy to visualize multilamellar structures

    • Fluorescence resonance energy transfer (FRET) to measure lipid mixing

    • Patch-clamp techniques to assess pore formation

    • Comparison of wild-type with mutant proteins lacking or having modified transmembrane segments

Understanding this unique property of A. punctulata bindin provides insights into the molecular mechanisms of gamete fusion and may have broader implications for membrane biology research .

How should I interpret contradictory results between recombinant and native bindin experiments?

When faced with discrepancies between recombinant and native bindin experimental results, a systematic analytical approach is essential:

  • Verify protein integrity:

    • Confirm proper folding using circular dichroism spectroscopy

    • Assess aggregation state through size exclusion chromatography

    • Validate complete sequence through mass spectrometry

    • Check for unexpected post-translational modifications

  • Analyze experimental conditions:

    • Compare buffer compositions, especially ionic strength and calcium concentrations

    • Verify pH consistency across experiments

    • Assess protein concentration effects (some functions may be concentration-dependent)

    • Consider temperature effects on protein conformation

  • Methodological examination:

    • Thoroughly examine the data to identify specific discrepancies

    • Evaluate initial assumptions and research design that may have influenced interpretation

    • Consider alternative explanations for contradictory results

    • Refine variables and implement additional controls to isolate the source of contradictions

  • Biological considerations:

    • Native bindin exists in a complex environment with cofactors

    • The transmembrane segment (residues 431-451) may require specific lipid compositions for proper function

    • Seasonal variations in gamete quality can affect binding assay results

Rather than viewing contradictions as experimental failures, consider them potential discoveries about context-dependent protein function or previously unrecognized regulatory mechanisms .

What strategies can help troubleshoot low expression yields of recombinant A. punctulata bindin?

Low expression yields of recombinant A. punctulata bindin are common due to its structural complexity. Consider these approaches:

  • Expression system optimization:

    • Test multiple expression systems (bacterial, yeast, insect, mammalian)

    • For bacterial systems, use specialized strains designed for membrane proteins

    • Consider cell-free expression systems for toxic proteins

  • Construct design improvements:

    • Optimize codon usage for the expression host

    • Try different fusion tags (His, GST, MBP) with various linker lengths

    • Create truncated constructs that exclude the problematic transmembrane segment (residues 431-451)

    • Use inducible promoters with tight regulation to minimize toxicity

  • Culture condition adjustments:

    • Reduce induction temperature (16-25°C) to slow expression and improve folding

    • Test varying inducer concentrations and induction times

    • Add chemical chaperones like glycerol, trehalose, or arginine to culture media

    • Consider using specialized media formulations for membrane proteins

  • Solubilization approaches:

    • Screen multiple detergents for extraction efficiency

    • Test detergent:protein ratios systematically

    • Consider bicelle or nanodisc systems for maintaining transmembrane domain integrity

Table of expression optimization parameters:

ParameterStarting ConditionOptimization RangeMonitoring Method
Temperature37°C16-30°CSDS-PAGE/Western blot
Inducer concentration1 mM IPTG0.1-2 mMActivity assay
Induction time4 hours2-24 hoursYield quantification
Media additivesNone5-15% glycerol, 0.5-1% glucoseSolubility assessment

By systematically testing these variables while monitoring both yield and functionality, researchers can optimize conditions for their specific recombinant bindin construct .

How can I distinguish between technical artifacts and true biological phenomena when studying species-specificity of bindin?

Distinguishing between technical artifacts and true biological phenomena is crucial when studying the species-specificity of bindin:

  • Implement robust controls:

    • Positive controls: Native bindin extracted directly from A. punctulata sperm

    • Negative controls: Denatured bindin or non-relevant proteins

    • Species controls: Test with multiple species to establish specificity gradients

    • Technical replicates: Perform binding assays in triplicate minimum

  • Cross-validate with multiple methods:

    • Complement egg binding assays with fertilization inhibition tests

    • Use both fluorescence microscopy and flow cytometry for binding quantification

    • Validate binding specificity with pull-down assays using egg surface receptors

  • Systematic analysis of variables:

    • Test binding at various developmental stages of eggs

    • Assess effects of egg preparation methods on receptivity

    • Evaluate bindin from individual males to account for polymorphism

    • Consider environmental factors (temperature, salinity) that might affect specificity

  • Statistical approaches:

    • Use appropriate statistical tests based on data distribution

    • Consider Bayesian approaches to differentiate biological variation from technical noise

    • Apply multivariate analysis to identify patterns across multiple experiments

When unexpected results emerge, researchers should evaluate whether the contradiction represents a genuine discovery about the complex biology of fertilization or reflects technical limitations in the experimental approach .

How might recombinant A. punctulata bindin contribute to conservation efforts for marine ecosystems?

Recombinant bindin research has potential applications in marine conservation:

  • Monitoring reproductive health: Bindin-based assays could assess fertilization capacity in wild sea urchin populations, providing early warning of reproductive decline due to environmental stressors.

  • Species identification: The species-specific nature of bindin makes it a potential molecular marker for identifying closely related echinoderm species in biodiversity surveys, particularly in larval stages that are morphologically similar.

  • Developing assisted reproductive technologies:

    • Similar to conservation efforts for endangered vertebrates, recombinant proteins could help develop artificial fertilization techniques for threatened marine invertebrates

    • Scientists are already using recombinant proteins to reprogram cells for conservation of endangered species

  • Understanding climate change impacts: By studying how bindin function is affected by ocean acidification and temperature changes, researchers can predict how climate change might impact reproductive success in marine invertebrates.

These applications leverage the fundamental research on bindin structure-function relationships while addressing pressing conservation challenges facing marine ecosystems.

What are the prospects for using A. punctulata bindin's unique transmembrane segment in biotechnology applications?

The unique transmembrane segment (residues 431-451) of A. punctulata bindin offers intriguing biotechnological potential:

  • Drug delivery systems:

    • The segment's ability to form multilamellar structures suggests potential use in liposome formulation for drug delivery

    • Its similarities to viral fusion peptides could be exploited to enhance cellular uptake of therapeutic molecules

  • Membrane protein research tools:

    • The segment could be used as a fusion tag to facilitate membrane protein reconstitution

    • Its unique properties might help stabilize difficult-to-express membrane proteins

  • Biosensor development:

    • The species-specific binding properties could be harnessed for developing highly specific biosensors

    • When combined with reporter systems, these could detect specific molecular targets

  • Tissue engineering applications:

    • The membrane-interacting properties might be useful for cell fusion in tissue engineering

    • Controlled delivery of growth factors in 3D cell culture systems could benefit from bindin-derived peptides

As with other recombinant proteins in biotechnology, the unique structural features of A. punctulata bindin offer versatile applications beyond its natural biological context .

How might CRISPR/Cas9 genome editing advance our understanding of bindin evolution and function?

CRISPR/Cas9 technology offers powerful approaches to study bindin:

  • In vivo functional studies:

    • Generate sea urchin strains with edited bindin genes to test structure-function hypotheses

    • Create chimeric bindins with domains swapped between species to identify regions responsible for species-specificity

    • Introduce the A. punctulata transmembrane segment (residues 431-451) into S. purpuratus bindin to test its functional significance

  • Receptor-ligand interaction studies:

    • Edit both bindin and its corresponding egg receptors to map interaction interfaces

    • Create reporter systems that activate upon successful bindin-receptor binding

    • Test evolutionary hypotheses about co-evolution of bindin and its receptors

  • Evolutionary analyses:

    • Systematically modify conserved versus variable regions to test selective pressure hypotheses

    • Reconstruct ancestral bindin sequences and express them to study evolutionary trajectories

    • Compare binding preferences of reconstructed ancestral proteins with contemporary variants

  • Methodological innovations:

    • Develop high-throughput screening systems for bindin function using CRISPR-edited cell lines

    • Create reporter sea urchins with fluorescently tagged bindin to visualize the fertilization process in real-time

These approaches would significantly advance our understanding of how bindin evolution contributes to speciation and the maintenance of reproductive barriers in marine ecosystems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.