Recombinant Archaeoglobus fulgidus Cobalamin synthase 1 (cobS1)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

CobS1 (UniProt ID: O30198) is a membrane-associated enzyme encoded by the cobS1 gene (locus tag: AF_0037) in Archaeoglobus fulgidus. It catalyzes two key reactions:

  • Condensation of adenosylcobinamide-GDP and α-ribazole to produce adenosylcobalamin (Ado-cobalamin), the biologically active form of vitamin B₁₂ .

  • Synthesis of adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

This enzyme is integral to the anaerobic cobalamin pathway, which diverges from the aerobic route by involving cobalt insertion early in the biosynthetic process .

Comparative Analysis of Aerobic vs. Anaerobic Pathways

CobS1’s role contrasts with aerobic enzymes like CobF, which utilize oxygen-dependent steps for C1 methylation. The anaerobic pathway employs cobS1 to bypass oxygen-sensitive intermediates, enabling cobalamin synthesis in environments like deep-sea hydrothermal vents where A. fulgidus thrives .

FeatureAnaerobic Pathway (CobS1)Aerobic Pathway (CobF)
Cobalt InsertionEarly stageLate stage
Key Methylation StepSAM-dependent (CbiD/CbiG) SAM/Oxygen-dependent (CobF)
Environmental NicheHypoxic/anaerobic habitatsOxygen-rich settings

Research Applications and Significance

  • Biotechnological Tool: Recombinant cobS1 supports synthetic biology efforts to engineer vitamin B₁₂ production in heterologous hosts .

  • Enzyme Mechanism Studies: Its partial activity in vitro (e.g., adenosylcobalamin-5'-phosphate synthesis) aids in probing corrin ring assembly .

  • Evolutionary Insights: CobS1’s minimalistic structure (compared to larger chelatases like CbiK) suggests ancestral gene duplication events in tetrapyrrole biosynthesis .

Open Questions and Future Directions

  • Structural Resolution: High-resolution crystallography of cobS1 is needed to elucidate substrate-binding motifs.

  • In Vivo Dynamics: How oligomerization or membrane interactions enhance catalytic efficiency remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have a specific format requirement, please specify it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS1; AF_0037; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
cobS1
Target Protein Sequence
MALDLLRSSLGFLTTLPVKGDVDVLRRNLWVFSFVGIFIGSVISIPAVLGFWFLCVLLYV AIEGVNHIDGLADFGDAFFAPEERKKVAIKDLNLGTGGAVFLCVYFLILFYSFQRVSAFY IIFSQVLAKFSMLLLLTTSKPAWQGMTGFMMEFARKRDVVIGSLPLLLVVLKPLAVFPLL FAITISLLVKRYAEEKFGGVSGDVVGASNCLVFAGSLLVCYFLAD
Uniprot No.

Target Background

Function
Cobalamin synthase 1 (CobS1) from *Archaeoglobus fulgidus* catalyzes the final two steps in cobalamin biosynthesis. It joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: afu:AF_0037

STRING: 224325.AF0037

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus Cobalamin synthase 1 (CobS1)?

Archaeoglobus fulgidus Cobalamin synthase 1 (CobS1) is an enzyme involved in the biosynthesis pathway of cobalamin (vitamin B12) in the hyperthermophilic euryarchaeon Archaeoglobus fulgidus. CobS1 belongs to a class of enzymes that participate in the assembly of the corrin ring structure of cobalamin. In the aerobic pathway of cobalamin biosynthesis, CobS works in conjunction with CobN and CobT to facilitate the insertion of cobalt(II) into the corrin ring structure . This enzyme is particularly notable for its thermostability, allowing it to function at the high temperatures that A. fulgidus typically inhabits.

How does CobS1 function in the context of the cobalamin biosynthetic pathway?

In the cobalamin biosynthetic pathway, CobS1 is part of a multi-component system involved in cobalt insertion into the corrin ring. The process of cobalt insertion represents a critical and committed step in the biosynthesis of vitamin B12. While specific detailed information about A. fulgidus CobS1 is limited in the available research, studies of homologous systems in organisms like Pseudomonas denitrificans show that CobN, CobS, and CobT function together to insert Co(II) into hydrogenobyrinic acid a,c-diamide to form Cob(II)yrinic acid a,c-diamide . This insertion process is particularly challenging biochemically due to the need for precise coordination of the metal ion within the macrocyclic structure.

What expression systems are most effective for recombinant production of A. fulgidus CobS1?

  • Codon optimization: The gene sequence should be optimized for E. coli codon usage to enhance translation efficiency.

  • Expression vectors: pET-series vectors with T7 promoter systems often provide good control and high-level expression for archaeal proteins.

  • Host strains: E. coli BL21(DE3) derivatives, particularly those with additional plasmids encoding rare tRNAs (like Rosetta strains), can improve expression of archaeal genes.

  • Temperature modulation: Lower induction temperatures (16-25°C) can improve proper folding even though the native enzyme functions at high temperatures.

  • Solubility enhancement: Fusion tags like MBP (maltose-binding protein) can significantly improve solubility of hyperthermophilic proteins expressed in mesophilic hosts.

For obtaining functional enzyme, it's often beneficial to use heat treatment as an initial purification step, as properly folded A. fulgidus proteins will remain soluble at temperatures that denature most E. coli proteins.

What purification strategies yield the highest activity for recombinant A. fulgidus CobS1?

A multi-step purification strategy is recommended for obtaining high-activity A. fulgidus CobS1:

  • Heat treatment (70-80°C for 15-30 minutes) to denature most E. coli proteins while retaining the thermostable CobS1

  • Affinity chromatography using an appropriate tag (His-tag or MBP)

  • Ion exchange chromatography to remove residual contaminants

  • Size exclusion chromatography for final polishing

The following table summarizes typical purification yields and specific activities that might be expected:

Purification StepTotal Protein (mg)CobS1 Activity (units)Specific Activity (units/mg)Recovery (%)Purification (fold)
Crude Extract1000200021001
Heat Treatment25018007.2903.6
Affinity Chromatography601500257512.5
Ion Exchange40130032.56516.3
Size Exclusion301200406020

It's essential to include stabilizing agents in the buffer systems throughout purification. Typical stabilizers include glycerol (10-20%), reducing agents like DTT or β-mercaptoethanol, and appropriate metal ions that may be required for structural integrity.

How can I confirm proper folding and activity of recombinant A. fulgidus CobS1?

Verifying proper folding and activity of recombinant A. fulgidus CobS1 requires multiple complementary approaches:

  • Thermostability assay: A properly folded hyperthermophilic enzyme should maintain activity after heating to temperatures that would denature mesophilic proteins (80-95°C).

  • Circular dichroism (CD) spectroscopy: This can verify secondary structure elements characteristic of properly folded proteins.

  • Activity assays: Functional assays measuring cobalt insertion activity are essential. A typical assay would monitor the conversion of hydrogenobyrinic acid a,c-diamide to Cob(II)yrinic acid a,c-diamide by spectrophotometric or HPLC-based methods.

  • Size exclusion chromatography: This can confirm that the protein exists in the expected oligomeric state.

  • Thermal shift assays: Differential scanning fluorimetry can provide melting temperatures (Tm) that should be significantly higher (>80°C) for properly folded A. fulgidus proteins compared to mesophilic homologs.

For activity assays, it's critical to establish proper reaction conditions, including temperature (typically 70-85°C), pH (often near neutral), buffer composition, and the presence of any required cofactors such as ATP/ADP and metal ions.

What are the optimal reaction conditions for A. fulgidus CobS1 activity?

A. fulgidus CobS1 activity is strongly influenced by reaction conditions that reflect its hyperthermophilic origin. Optimal conditions typically include:

  • Temperature: 80-85°C, reflecting the hyperthermophilic nature of A. fulgidus.

  • pH: Generally between 6.5-7.5, with optimal activity often around pH 7.0.

  • Ionic strength: Moderate to high salt concentrations (200-500 mM NaCl) often enhance stability.

  • Divalent cations: Mg²⁺ (5-10 mM) is typically required for activity.

  • Reducing environment: The addition of reducing agents (1-5 mM DTT or β-mercaptoethanol) can help maintain cysteine residues in the reduced state.

  • Nucleotides: As with other CobS proteins, A. fulgidus CobS1 likely requires ATP for activity. Interestingly, research on A. fulgidus enzymes has shown that both ATP and ADP can stimulate activity, with ADP potentially being more important in vivo due to its higher heat stability .

The table below illustrates the relationship between temperature and relative activity that might be expected for A. fulgidus CobS1:

Temperature (°C)Relative Activity (%)
4015
5035
6055
7080
80100
8595
9075
9540
10020

How does the thermostability of A. fulgidus CobS1 compare to cobalamin synthases from mesophilic organisms?

A. fulgidus CobS1 exhibits remarkable thermostability compared to its mesophilic counterparts due to structural adaptations for high-temperature environments. Key differences include:

  • Thermal denaturation midpoint (Tm): While mesophilic cobalamin synthases typically show Tm values of 40-55°C, A. fulgidus CobS1 would be expected to have a Tm above 85°C.

  • Activity half-life: At 60°C, mesophilic enzymes might be inactivated within minutes, while A. fulgidus CobS1 should retain substantial activity for hours.

  • Chemical denaturation resistance: A. fulgidus CobS1 likely requires higher concentrations of denaturants (urea, guanidinium hydrochloride) to unfold.

  • Proteolytic resistance: Increased structural rigidity typically confers greater resistance to proteolytic degradation.

The thermostability of A. fulgidus CobS1 makes it potentially valuable for biotechnological applications requiring thermal resistance, though this must be balanced against its specific temperature requirements for optimal activity. The heightened stability may also provide practical advantages during purification and handling, as heat treatment steps can be employed to remove less stable contaminants.

What is known about the kinetic parameters of A. fulgidus CobS1?

While specific kinetic parameters for A. fulgidus CobS1 have not been widely reported in the literature, we can discuss expected parameters based on related enzymes and general principles. Typical kinetic parameters that would be measured include:

  • Km values for substrates (hydrogenobyrinic acid a,c-diamide and Co²⁺)

  • kcat (turnover number)

  • kcat/Km (catalytic efficiency)

  • Activation energy (Ea)

  • Temperature dependence of catalytic rates

A comparative table of hypothetical kinetic parameters for CobS enzymes from different temperature-adapted organisms might look like this:

ParameterA. fulgidus CobS1 (Hyperthermophile)P. denitrificans CobS (Mesophile)E. coli Homolog (Mesophile)
Optimal Temperature80-85°C30-37°C37°C
Km for Hydrogenobyrinic acid a,c-diamide5-15 μM2-8 μM3-10 μM
Km for Co²⁺20-50 μM10-30 μM15-40 μM
kcat0.5-2.0 s⁻¹ at 80°C1.0-3.0 s⁻¹ at 37°C0.8-2.5 s⁻¹ at 37°C
Activation Energy (Ea)60-80 kJ/mol40-60 kJ/mol45-65 kJ/mol
Half-life at 80°C>120 min<1 min<1 min

Kinetic studies of A. fulgidus CobS1 would be particularly interesting to determine whether it follows expected Arrhenius behavior or exhibits temperature-dependent changes in reaction mechanism. Given that A. fulgidus enzymes can utilize ADP effectively, perhaps due to the greater heat stability of ADP compared to ATP , investigating nucleotide preferences and their kinetic effects would also be valuable.

What methods are recommended for studying the structure-function relationship of A. fulgidus CobS1?

To investigate structure-function relationships in A. fulgidus CobS1, several complementary approaches are recommended:

When designing mutagenesis experiments, it's important to evaluate both activity and thermostability for each mutant, as these properties may be affected independently.

How can I establish a reliable activity assay for A. fulgidus CobS1?

Developing a robust activity assay for A. fulgidus CobS1 requires careful consideration of its biochemical function and optimal reaction conditions. A comprehensive assay strategy would include:

  • Direct activity measurement:

    • Spectrophotometric detection of cobalt insertion (changes in absorption spectra of the corrin ring upon cobalt insertion)

    • HPLC-based separation and quantification of substrate and product

    • LC-MS detection for definitive product identification

  • Coupled assay systems:

    • ATP hydrolysis measurement (if ATP is required)

    • Coupling to subsequent enzymatic steps in the pathway

  • Key considerations for assay development:

    • Temperature control: Assays must be conducted at elevated temperatures (70-85°C)

    • Substrate availability: Synthesize or isolate hydrogenobyrinic acid a,c-diamide

    • Buffer stability at high temperatures

    • Enzyme concentration optimization to ensure initial velocity conditions

    • Proper controls for non-enzymatic reactions at high temperatures

  • Validation strategies:

    • Confirm linear relationship between enzyme concentration and activity

    • Verify product identity by mass spectrometry

    • Demonstrate dependence on all required cofactors

    • Establish reproducibility across different enzyme preparations

A detailed protocol might include:

  • Pre-incubation of reaction buffer and substrates at the target temperature

  • Addition of pre-warmed enzyme solution

  • Incubation for defined time periods

  • Rapid cooling to stop the reaction

  • Analysis of products using appropriate detection methods

What approaches are effective for studying protein-protein interactions involving A. fulgidus CobS1?

Since CobS1 is expected to function in conjunction with other proteins (like CobN and CobT) in the cobalamin biosynthetic pathway , investigating these interactions is essential. Effective methods include:

  • Co-purification approaches:

    • Co-expression of potential interaction partners with different affinity tags

    • Pull-down assays under varying conditions (temperature, ionic strength, nucleotide presence)

    • Size exclusion chromatography to detect complex formation

  • Biophysical techniques:

    • Surface plasmon resonance (SPR) modified for high-temperature measurements

    • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

    • Microscale thermophoresis (MST) for interaction studies in solution

    • Analytical ultracentrifugation to determine complex stoichiometry

  • Structural approaches:

    • Cryo-electron microscopy of the intact complex

    • Cross-linking mass spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify regions protected upon complex formation

  • Functional validation:

    • Reconstitution of complete activity with purified components

    • Mutagenesis of predicted interface residues to disrupt interactions

    • Competition assays with peptides derived from interaction interfaces

When studying interactions involving thermophilic proteins, it's particularly important to consider temperature effects on complex formation. Interactions that appear weak at room temperature may be significantly stronger at physiologically relevant temperatures for the hyperthermophile.

How might A. fulgidus CobS1 contribute to our understanding of enzyme adaptation to extreme environments?

A. fulgidus CobS1 represents an excellent model system for studying enzyme adaptation to extreme environments for several reasons:

  • Thermostability mechanisms: Comparative studies between A. fulgidus CobS1 and mesophilic homologs can reveal specific adaptations that enhance protein stability at high temperatures. These may include increased ionic interactions, hydrogen bonding networks, hydrophobic packing, and reduced surface loop regions.

  • Activity-stability trade-offs: Investigating how A. fulgidus CobS1 maintains catalytic efficiency at high temperatures while preserving structural integrity can provide insights into the evolutionary balance between flexibility needed for catalysis and rigidity required for stability.

  • Cofactor stability: Studies of A. fulgidus enzymes have shown that they may prefer ADP over ATP in certain reactions, possibly due to the greater heat stability of ADP . This adaptation represents an interesting example of how thermophiles deal with heat-labile cofactors.

  • Protein-protein interactions: The CobS1 protein likely functions in a complex with other proteins (CobN, CobT) in the cobalamin biosynthetic pathway . Studying how these interactions are maintained at high temperatures can reveal principles of protein-protein interface adaptation in thermophiles.

  • Evolutionary insights: Comparing CobS proteins across the tree of life, particularly focusing on organisms from different thermal environments, can provide insights into the evolutionary pathways leading to thermostabilization.

Research on A. fulgidus CobS1 could contribute to broader questions about protein evolution in extreme environments and inform protein engineering efforts aimed at enhancing thermostability for biotechnological applications.

What are the challenges in reconstituting the complete cobalamin biosynthetic pathway using recombinant A. fulgidus enzymes?

Reconstituting the complete cobalamin biosynthetic pathway using A. fulgidus enzymes presents several significant challenges:

  • Pathway complexity: The cobalamin biosynthetic pathway involves numerous enzymatic steps and intermediate compounds. In different organisms, the pathway can proceed via either aerobic or anaerobic routes with distinct enzymes involved . Determining the specific route and all enzymes involved in A. fulgidus is a prerequisite for reconstitution.

  • Gene identification and annotation: Not all genes involved in the A. fulgidus cobalamin biosynthetic pathway may be correctly annotated. Comparative genomics, biochemical validation, and complementation studies may be needed to identify all pathway components.

  • Enzyme interdependence: Some enzymes may require the presence of other pathway components for proper folding, stability, or activity. For example, studies have suggested that certain Cbi proteins may form complexes that are necessary for efficient function .

  • Precursor availability: Synthesizing or isolating the various tetrapyrrole intermediates required for assaying pathway steps presents technical challenges.

  • High-temperature reactions: Maintaining reaction conditions at 80-85°C for extended periods while preventing evaporation and degradation of labile intermediates requires specialized equipment and methodology.

  • Cofactor stability: Many cofactors required for the pathway (ATP, SAM, NADPH) are less stable at high temperatures. As noted with A. fulgidus enzymes, adaptations like the use of ADP instead of ATP may occur , requiring careful optimization of reaction conditions.

  • Intermediate channeling: In vivo, pathway intermediates may be channeled directly between enzymes without release into solution. Recreating this efficiency in vitro is challenging.

The table below summarizes key components that would need to be reconstituted for a minimal A. fulgidus cobalamin biosynthetic pathway:

Pathway StepLikely A. fulgidus EnzymeFunctionKey Challenges
Uroporphyrinogen III methylationCysG homologC-2 and C-7 methylationIdentifying the specific enzyme
Cobalt insertionCbiK/CobN-CobS-CobT complexMetal chelationComplex reconstitution at high temperature
Ring contractions and modificationsCbiH, CbiF, CbiG homologsRing structure formationIntermediate stability at high temperature
Side chain modificationsCbiA, CbiP homologsAmidation reactionsSubstrate specificity confirmation
Nucleotide loop assemblyCobU, CobT, CobS homologsLower ligand attachmentComplex multi-step process

How can structural data from A. fulgidus CobS1 inform protein engineering efforts?

Structural data from A. fulgidus CobS1 can provide valuable insights for protein engineering in several ways:

  • Thermostability engineering: Identifying structural features that contribute to the extreme thermostability of A. fulgidus CobS1 can inform rational design strategies to enhance the thermal resistance of mesophilic enzymes. These features might include:

    • Specific ionic interaction networks

    • Optimized hydrophobic cores

    • Strategic placement of proline residues in loops

    • Increased hydrogen bonding patterns

    • Surface charge distribution patterns

  • Substrate specificity modification: Understanding the structural basis of substrate recognition by CobS1 could guide efforts to modify substrate specificity of related enzymes for biotechnological applications.

  • Chimeric protein design: Structural information can identify domain boundaries and modular regions that could be used to create chimeric proteins with combined properties from different sources.

  • Catalytic efficiency enhancement: Comparing the active site architecture of A. fulgidus CobS1 with less efficient homologs could reveal determinants of reaction rate that could be engineered into other enzymes.

  • Protein-protein interaction engineering: If structures of CobS1 in complex with partner proteins (CobN, CobT) become available, these could guide the design of optimized protein interfaces or the creation of artificial multi-enzyme complexes.

  • Stability-function balance: Understanding how A. fulgidus CobS1 balances the competing demands of thermostability and catalytic function could inform strategies to optimize this balance in engineered proteins.

  • Cofactor binding optimization: Structural insights into nucleotide binding (ATP/ADP) could help engineer proteins with modified cofactor preferences or reduced cofactor dependencies.

By applying these insights from A. fulgidus CobS1 structural data, protein engineers could develop enzymes with enhanced stability for industrial applications, modified substrate specificity for novel biotransformations, or optimized activity under extreme conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.