Recombinant Archaeoglobus fulgidus Cobalamin synthase 2 (cobS2)

Shipped with Ice Packs
In Stock

Description

Biological Source and Classification

Archaeoglobus fulgidus is a hyperthermophilic archaeon that thrives in extreme environments, typically characterized by high temperatures and often challenging chemical conditions. The organism serves as the natural source of Cobalamin synthase 2 (cobS2), which belongs to the transferase enzyme family . This enzyme is officially classified as adenosylcobinamide-GDP ribazoletransferase (EC 2.7.8.26) and is also known by several synonyms including cobalamin synthase and cobalamin-5'-phosphate synthase . The enzyme plays a critical role in the biosynthetic pathway leading to the formation of cobalamin (vitamin B12), an essential cofactor for numerous metabolic processes across various forms of life.

Recombinant Production Context

For research and commercial purposes, cobS2 is produced as a recombinant protein primarily using Escherichia coli expression systems . This approach facilitates the production of substantial quantities of the protein in a form suitable for detailed biochemical and structural analysis. The recombinant version is typically engineered with an N-terminal histidine tag, which significantly enhances purification efficiency through affinity chromatography techniques . Such recombinant production methods have made this archaeal enzyme more accessible for scientific investigation despite its origin from an extremophile source.

Physical and Chemical Characteristics

Commercially available recombinant cobS2 is typically supplied as a lyophilized powder with purity exceeding 90% as determined by SDS-PAGE analysis . The protein is prepared in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain structural integrity during storage . When reconstituting the protein for experimental use, it is recommended to use deionized sterile water to achieve concentrations between 0.1-1.0 mg/mL .

For optimal stability during long-term storage, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard in commercial preparations . Under these conditions, properly aliquoted samples can be stored at -20°C or -80°C, though repeated freeze-thaw cycles should be avoided to preserve enzymatic activity . Working aliquots can be maintained at 4°C for up to one week with minimal loss of functionality .

Catalytic Activity and Reaction Mechanism

Cobalamin synthase 2 (cobS2) functions as an adenosylcobinamide-GDP ribazoletransferase, catalyzing critical reactions in the cobalamin biosynthetic pathway . The enzyme specifically mediates the transfer of the ribazole moiety from α-ribazole or α-ribazole 5'-phosphate to adenosylcobinamide-GDP, resulting in the formation of adenosylcobalamin or adenosylcobalamin 5'-phosphate, respectively . These reactions can be represented as follows:

  1. adenosylcobinamide-GDP + α-ribazole → GMP + adenosylcobalamin

  2. adenosylcobinamide-GDP + α-ribazole 5'-phosphate → GMP + adenosylcobalamin 5'-phosphate

The enzyme's ability to efficiently catalyze these transformations is essential for the complete assembly of the complex cobalamin molecule. This catalytic activity represents a critical step in the biosynthesis of vitamin B12, which serves as an essential cofactor for numerous enzymatic reactions across diverse biological systems.

Role in Vitamin B12 Biosynthesis

Within bacterial systems, cobS2 occupies a pivotal position in the cobalamin biosynthetic pathway . Vitamin B12 is a structurally complex molecule consisting of a corrin ring with a central cobalt atom and various peripheral modifications. The reactions catalyzed by cobS2 effectively join the upper corrin part (adenosylcobinamide-GDP) with the lower ribazole portion, forming the complete cobalamin structure . This assembly process is critical for generating functional vitamin B12, which serves as an essential cofactor for enzymes involved in methylation reactions, amino acid metabolism, and DNA synthesis across various organisms.

The importance of this biosynthetic pathway extends beyond bacterial systems, as many organisms, including humans, require vitamin B12 but cannot synthesize it independently, necessitating dietary intake or microbial production in the gut. Understanding the enzymatic mechanisms involved in cobalamin synthesis, including the specific contributions of cobS2, has significant implications for nutritional biochemistry and potential biotechnological applications in vitamin production.

Market Sources and Product Formats

Recombinant Archaeoglobus fulgidus Cobalamin synthase 2 is commercially available from several suppliers, catering to research needs in biochemistry, enzymology, and related fields. Based on current market information, the protein can be obtained from:

  1. MyBioSource.com, which offers the recombinant protein at a price point of $1,445.00

  2. Creative BioMart, which supplies the product under catalog number RFL7021AF

These commercial preparations provide the full-length protein (231 amino acids) with an N-terminal histidine tag to facilitate purification and downstream applications . The recombinant protein is expressed in E. coli systems, ensuring consistent quality and scalable production capabilities .

Thermostable Enzyme Profile

Archaeoglobus fulgidus produces several notable enzymes characterized by remarkable thermostability and activity under extreme conditions. Comparing cobS2 with other enzymes from the same organism provides valuable context for understanding its biochemical properties. The table below presents a comparative analysis of selected enzymes from A. fulgidus:

EnzymeFunctionOptimal ConditionsNotable Characteristics
Cobalamin synthase 2 (cobS2)Adenosylcobinamide-GDP ribazoletransferaseNot specifically documentedEssential for vitamin B12 biosynthesis
CopBCu²⁺-ATPase (heavy metal ion transport)Active at 75°C and high ionic strengthActivated by Cu²⁺ with high apparent affinity (K₁/₂ = 0.28 μM)
AFL (lipase)Lipid hydrolysisTemperature range: 70-90°C; pH: 10-11Alkalohyperthermophilic enzyme with preference for long-chain substrates

While specific thermal stability parameters for cobS2 are not explicitly documented in the available research, enzymes from A. fulgidus typically demonstrate exceptional thermostability, often maintaining activity at temperatures between 70-90°C . This characteristic makes them particularly valuable for biotechnological applications requiring enzymatic activity under extreme conditions.

Current Research Utility

Recombinant Archaeoglobus fulgidus Cobalamin synthase 2 serves several important functions in current research contexts. Primary applications include:

  1. Studying the biochemical mechanisms of vitamin B12 biosynthesis, particularly the ribazole transfer reactions critical for cobalamin assembly

  2. Investigating enzyme adaptations to extreme environmental conditions, especially high-temperature stability

  3. Developing model systems for understanding archaeal biochemistry and evolution

  4. Exploring potential biotechnological applications leveraging the enzyme's presumed thermostability

The availability of purified recombinant preparations has facilitated these research directions, allowing detailed biochemical characterization and functional analysis outside the native archaeal context.

Future Research Directions and Potential Applications

Several promising avenues exist for future research involving Archaeoglobus fulgidus Cobalamin synthase 2:

  1. Comprehensive structural determination through X-ray crystallography or cryo-electron microscopy to elucidate the molecular basis of its thermostability and catalytic mechanism

  2. Protein engineering efforts to enhance specific properties for biotechnological applications, potentially creating variants with improved catalytic efficiency or stability

  3. Exploration of its potential utility in industrial vitamin B12 production processes, particularly under conditions where thermostability provides advantages

  4. Comparative analysis with homologous enzymes from mesophilic organisms to understand evolutionary adaptations to extreme environments

The continued investigation of this enzyme may yield valuable insights into both fundamental biochemical principles and practical applications in biotechnology and pharmaceutical production. The thermostable nature of enzymes from hyperthermophilic archaea like A. fulgidus makes them particularly attractive for industrial processes requiring stability under harsh conditions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please include them in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
cobS2; AF_2323; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
cobS2
Target Protein Sequence
MIKAIRSAISFLTTLPLGGDVEELRKNLWLFPYAAILIALIVSVPHFIRNFVDIRFLALV LYLGAEGINHVDGLADFGDALFAPKNRKREAIKDLNTGAGGVAVVVVYFLLLYTLLYRSD FWEIALSQVLAKYSMLLLMLLSRPSWDGMGSYFMEKISSKDVFIGAVPVVLLCYKVGIES LAALASGFAVVLLLKAYSEKHFGGVNGDVIGSANCLTFAASLSALTIAGQL
Uniprot No.

Target Background

Function
Catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and alpha-ribazole. It also produces adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: afu:AF_2323

STRING: 224325.AF2323

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Cobalamin Synthase 2 in Archaeoglobus fulgidus?

Cobalamin Synthase 2 (CobS2) in Archaeoglobus fulgidus plays a crucial role in the biosynthesis of cobalamin (vitamin B12), which is an essential cofactor for various metabolic processes. A. fulgidus is a hyperthermophilic, sulfate-reducing archaeon that utilizes carbon monoxide (CO) as an energy source and demonstrates remarkable resistance to high CO concentrations . While the search results don't specifically detail CobS2's function, we can infer its importance within the context of A. fulgidus' metabolism based on related cobalamin-dependent enzymes.

Cobalamin-dependent enzymes like methionine synthase require properly synthesized cobalamin for their function. These enzymes typically feature specialized domains that bind specific substrates and the cobalamin cofactor, as seen in methionine synthase which contains a conserved cobalamin-binding domain (Cob) that carries the cobalamin molecule . In A. fulgidus, the cobalamin synthesis pathway likely supports various metabolic functions, particularly in anaerobic respiration and carbon fixation pathways.

The significance of cobalamin synthesis in A. fulgidus is highlighted by the organism's metabolic flexibility, which allows it to thrive in extreme environments through various energy conservation strategies, including those that may involve cobalamin-dependent enzymes .

What expression systems are recommended for producing recombinant A. fulgidus CobS2?

Expression of recombinant proteins from hyperthermophilic archaea like A. fulgidus presents unique challenges due to their extreme native environments. For CobS2, several expression systems can be considered based on general recombinant protein methodology and the specific requirements of hyperthermophilic enzymes.

Table 2.2: Recommended Expression Systems for Recombinant A. fulgidus CobS2

Expression SystemAdvantagesConsiderationsOptimal Conditions
E. coli BL21(DE3)High yield, economical, well-established protocolsMay require codon optimization, potential inclusion body formationInduction at OD600 0.6-0.8, 18-25°C post-induction
E. coli RosettaEnhanced expression of proteins with rare codonsHigher cost than standard strains, may still require thermal stability optimizationIPTG 0.1-0.5 mM, 18-25°C post-induction
Thermophilic expression hosts (T. thermophilus)Better folding of thermostable proteinsLower yields, less established protocolsNative temperature range (55-75°C)
Cell-free systemsAvoids toxicity issues, direct access to reaction conditionsHigher cost, smaller scaleSupplementation with specific cofactors

When selecting an expression system, researchers should consider that A. fulgidus proteins are typically thermostable and may require optimization of growth temperatures during expression. Based on approaches used for similar archaeal proteins, E. coli systems remain the most accessible, though they may require careful optimization of induction conditions and solubility enhancement strategies.

For proteins involved in cobalamin metabolism, like the cobalamin-binding proteins described in the literature, purification often benefits from including a stabilization step that preserves the interaction between the protein and its cofactor . This might involve supplementing the growth medium or purification buffers with cobalamin precursors or stabilizing agents.

What are the most effective purification techniques for recombinant CobS2?

Purifying recombinant CobS2 from A. fulgidus requires techniques that account for both its thermostable nature and potential interactions with cobalamin cofactors. Based on general protein purification principles and considerations for similar enzymes, the following approach is recommended:

Table 2.3: Purification Strategy for Recombinant A. fulgidus CobS2

Purification StepMethodBuffer CompositionSpecial Considerations
Initial CaptureImmobilized Metal Affinity Chromatography (IMAC)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazoleConsider heat treatment (70-80°C) prior to IMAC to exploit thermostability
Intermediate PurificationIon Exchange Chromatography20 mM HEPES pH 7.5, 50-500 mM NaCl gradientSelect column based on theoretical pI of CobS2
PolishingSize Exclusion Chromatography20 mM HEPES pH 7.5, 150 mM NaClAssess oligomeric state, analyze peaks for cobalamin content
Optional StepHydrophobic Interaction Chromatography50 mM phosphate pH 7.0, 1.5 M ammonium sulfateParticularly useful if lipophilic cobalamin intermediates are bound

When purifying cobalamin-related enzymes, it's crucial to consider whether the protein should retain its cofactor during purification. For structural studies, capturing the enzyme-cofactor complex may be desirable. This approach has been successfully used for other cobalamin-binding enzymes, where researchers have captured the binding of cobalamin to the protein in crystallographic studies .

What structural characteristics define the CobS2 enzyme?

While specific structural data for A. fulgidus CobS2 is not directly provided in the search results, we can draw informative parallels with other cobalamin-binding enzymes whose structures have been characterized. Cobalamin-dependent enzymes typically feature specialized domains for cofactor binding and catalysis, as exemplified by methionine synthase.

Cobalamin-binding domains in enzymes like methionine synthase contain critical features for cofactor interaction. The cobalamin-binding domain (Cob) carries the cobalamin molecule, while adjacent domains often serve protective or regulatory functions. For instance, in methionine synthase, a Cap domain protects the reactive cofactor from unwanted side reactions during catalytic cycling .

The structural arrangement of these domains allows for "molecular juggling," where the enzyme adopts multiple conformations to facilitate different steps of the catalytic cycle. This dynamic rearrangement enables the correct positioning of substrates relative to the cobalamin cofactor .

For CobS2 specifically, we would expect:

  • A conserved domain architecture with a dedicated cobalamin-binding region

  • Potential conformational flexibility to accommodate the different steps of cobalamin synthesis

  • Thermostable structural elements consistent with A. fulgidus' hyperthermophilic nature

  • Possible coordinating residues for metal ions (such as histidine residues that can coordinate cobalt within the cobalamin structure)

The hyperthermophilic nature of A. fulgidus (growth optimum at 83°C) suggests that its enzymes, including CobS2, would contain structural adaptations for thermostability, such as increased ionic interactions, compact hydrophobic cores, and reduced flexible loops compared to mesophilic homologs .

How should activity assays be designed for functionally characterizing recombinant CobS2?

Designing robust activity assays for recombinant CobS2 requires careful consideration of the enzyme's native reaction conditions, substrate availability, and detection methods. As a cobalamin biosynthesis enzyme from a hyperthermophilic archaeon, special attention must be paid to temperature, pH, and redox conditions.

Table 3.1: Activity Assay Design for A. fulgidus CobS2

Assay ComponentRecommended ApproachJustificationMethodological Considerations
Temperature80-85°CMatches A. fulgidus growth optimum (83°C) Use sealed pressure-resistant tubes to prevent evaporation
Buffer System50 mM PIPES or HEPES, pH 7.0-7.5Provides pH stability at high temperaturesPre-adjust pH at assay temperature, not room temperature
Substrate PreparationPrecorrin intermediates or synthetic analogsSpecific to CobS2's position in the pathwayConsider chemically synthesized or enzymatically prepared substrates
Detection MethodHPLC-MS analysisAllows identification of cobalamin precursors and productsInclude authentic standards for product confirmation
Coupling EnzymesUpstream and downstream enzymes in the pathwayCreates a coupled assay systemMay require expression of additional pathway enzymes
Control ReactionsHeat-inactivated enzyme, no substrate controlsEstablishes baseline and non-enzymatic ratesCritical for high-temperature assays where spontaneous reactions may occur

When designing your assay, implement a focused experimental question using the PICO framework (Patient/Problem, Intervention, Comparison, Outcome) . For CobS2, this might translate to:

  • Problem: Uncertainty about CobS2 substrate specificity

  • Intervention: Testing CobS2 activity with different precorrin substrates

  • Comparison: Comparing activity rates across substrate variants

  • Outcome: Determining substrate preference and kinetic parameters

This structured approach ensures your assay directly addresses your research question while generating quantifiable results. Additionally, given that A. fulgidus has been studied for its carbon monoxide metabolism , consider investigating whether CO exposure affects CobS2 activity, as this might reveal interesting regulatory mechanisms in this unique organism.

How can researchers reconcile contradictory data in CobS2 characterization studies?

When confronted with contradictory data in CobS2 characterization studies, researchers should adopt a systematic approach to identify potential sources of discrepancy and design experiments to resolve the contradictions. This is particularly important when working with enzymes from extremophiles like A. fulgidus, where experimental conditions may significantly impact results.

First, implement a structured evaluation of the contradictory data using evidence-based methodology principles. This involves formulating a focused question about the contradiction using the PICO framework to guide your investigation . For example:

  • Problem: Conflicting activity measurements of CobS2

  • Intervention: Standardized assay conditions across laboratories

  • Comparison: Original conditions from each contradictory study

  • Outcome: Resolution of discrepancies and identification of critical parameters

When analyzing contradictory results, consider the following potential sources of variation:

  • Expression construct differences: Variations in affinity tags, fusion partners, or expression vectors can significantly impact enzyme properties. Document and compare these differences systematically.

  • Assay condition variations: For hyperthermophilic enzymes like those from A. fulgidus, even small differences in temperature, pH, or salt concentration can dramatically affect results . Create a comprehensive table comparing all assay parameters between studies.

  • Enzyme preparation methods: The presence or absence of bound cofactors during purification can alter enzyme behavior. For instance, whether cobalamin is present during purification could affect subsequent activity measurements .

  • Substrate quality and sources: For cobalamin pathway enzymes, substrate purity and isomeric forms are critical considerations that could explain activity differences.

To resolve contradictions, design definitive experiments that:

  • Test multiple hypotheses simultaneously with appropriate controls

  • Use research co-production approaches where labs with conflicting results collaborate directly

  • Employ orthogonal measurement techniques to validate findings

  • Standardize critical reagents and share them between laboratories

Remember that contradictions often reveal important biological insights about enzyme regulation, substrate specificity, or cofactor requirements that weren't initially apparent.

What strategies optimize expression and stability of recombinant A. fulgidus CobS2?

Optimizing expression and stability of recombinant CobS2 from A. fulgidus presents unique challenges due to its thermophilic origin and potential cofactor requirements. Successful strategies must address protein folding, solubility, and functional integrity throughout the expression and purification process.

Table 3.3: Optimization Strategies for Recombinant CobS2 Expression and Stability

ChallengeOptimization StrategyImplementation ApproachExpected Outcome
Codon biasCodon optimizationSynthesize gene with E. coli-preferred codonsImproved translation efficiency
Protein foldingChaperone co-expressionCo-transform with pGro7 (GroEL/ES) or pTf16 (Trigger factor)Enhanced soluble protein fraction
Expression temperatureLow-temperature inductionReduce to 15-18°C after inductionSlower expression allowing proper folding
Inclusion body formationFusion partnersN-terminal SUMO, MBP, or GST tagsIncreased solubility
Cofactor availabilityMedia supplementationAdd precursors or complete cobalaminProper folding of cofactor-binding regions
Protein stabilityBuffer optimizationInclude glycerol, reducing agents, specific ionsProlonged enzyme stability
Thermostability verificationCircular dichroism at elevated temperaturesMonitor secondary structure at 25-85°CConfirmation of proper folding

When working with enzymes from hyperthermophiles like A. fulgidus, which grows optimally at 83°C , it's important to recognize that expression in mesophilic hosts may result in partially misfolded proteins. Consider implementing a post-expression "heat activation" step where the purified protein is briefly incubated at elevated temperatures (60-70°C) to promote correct folding before final purification steps.

For cobalamin-binding enzymes specifically, the cofactor often plays a crucial structural role beyond its catalytic function. Studies of other cobalamin-dependent enzymes have demonstrated that cofactor binding can induce significant conformational changes . Therefore, supplementing expression media or purification buffers with cobalamin or its precursors may significantly improve both expression yield and stability of the recombinant enzyme.

Researchers should also consider the potential impact of the A. fulgidus native environment on protein stability. As a sulfate-reducing organism , CobS2 may have evolved to function optimally under specific redox conditions. Including appropriate reducing agents (such as DTT or β-mercaptoethanol) in buffers may help maintain the protein in its native conformation.

How do structure-function relationships in CobS2 compare to other cobalamin biosynthesis enzymes?

Understanding the structure-function relationships in CobS2 requires comparative analysis with other cobalamin biosynthesis enzymes, incorporating insights from both archaea and bacteria. While specific structural data for A. fulgidus CobS2 is not directly available in the search results, we can draw meaningful comparisons with related cobalamin-binding enzymes.

Cobalamin-dependent enzymes often share common structural features despite diverse functions. For example, methionine synthase contains a dedicated cobalamin-binding domain (Cob) along with substrate-specific domains arranged to facilitate complex catalytic cycles through conformational changes . These domains must coordinate precisely to enable "molecular juggling" - the sequential positioning of different substrates relative to the cobalamin cofactor.

A key structural feature likely present in CobS2 is a histidine residue that coordinates the cobalt ion in cobalamin. In methionine synthase, His761 has been identified as a critical cobalt-coordinating residue that can adopt different orientations upon cobalamin incorporation, potentially tuning the reactivity of the cofactor . This residue serves as a communication link between the cofactor and the protein's conformational state.

Table 3.4: Comparative Structure-Function Elements in Cobalamin-Processing Enzymes

Structural ElementFunction in CobS2 (predicted)Comparison with Methionine SynthaseEvolutionary Implications
Cobalamin-binding domainPositions cobalamin for specific modificationConserved domain (Cob) carries cobalamin Core structure conserved across domains of life
Protective domainsShields reactive intermediatesCap domain protects reactive cofactor Evolved to prevent side reactions in diverse environments
Substrate-binding regionsRecognition of pathway-specific intermediatesSpecialized domains bind each substrate Diversified through evolution to accommodate different pathways
Conformational flexibilityAllows multi-step catalysis"Molecular juggling" facilitates different reactions Common mechanism adapted to different reaction sequences
Thermostable elementsEnables function at high temperaturesLess prominent in mesophilic enzymesAdaptation to A. fulgidus' hyperthermophilic lifestyle

In A. fulgidus, structural adaptations for thermostability likely influence CobS2's structure-function relationships. These may include increased ionic interactions, more extensive hydrophobic packing, and reduced flexible loops compared to mesophilic homologs. Such adaptations could potentially constrain conformational dynamics while still allowing necessary catalytic movements.

The intersection of thermostability and catalytic flexibility represents a fascinating evolutionary compromise in A. fulgidus enzymes. Understanding how CobS2 balances these potentially competing requirements could provide valuable insights for protein engineering applications and our broader understanding of enzyme evolution in extreme environments.

What crystallization approaches are most effective for structural studies of A. fulgidus CobS2?

Obtaining high-quality crystals of recombinant CobS2 from A. fulgidus presents specific challenges due to the enzyme's thermophilic nature and potential cofactor requirements. Based on successful approaches with similar proteins, the following methodological framework is recommended.

Table 4.1: Crystallization Strategy for A. fulgidus CobS2

Crystallization AspectRecommended ApproachRationalePractical Considerations
Protein PreparationUltra-high purity (>98%) with defined cofactor stateHomogeneity is critical for crystal formationConsider both apo and holo forms for comparative studies
Initial ScreeningSparse matrix at multiple temperatures (4°C, 20°C, 37°C)Temperature affects both protein stability and crystal growth kineticsUse commercial screens designed for thermophilic proteins
Optimization VariablesPEG MW, concentration, pH, additivesSystematic variation identifies optimal conditionsFocus on conditions that produce microcrystals in initial screens
Cofactor ConsiderationsCrystallization with and without cobalaminMay capture different conformational statesAddition of cobalamin in crystallo can provide mechanistic insights
Crystal StabilizationAddition of cryoprotectants compatible with crystallization conditionPrevents ice formation during flash-coolingTest multiple cryoprotectants at different concentrations
Alternative ApproachesIn situ proteolysis, surface entropy reductionReduces surface flexibility that might hinder crystallizationDesign constructs with reduced surface entropy based on computational prediction

One particularly relevant approach demonstrated with cobalamin-dependent enzymes is capturing cofactor binding in crystallo. Researchers studying methionine synthase successfully captured cobalamin loading by introducing the cofactor to pre-formed protein crystals, providing valuable insights into conformational changes upon cofactor binding . This technique could be especially informative for CobS2 if crystallization of the apo-form proves more tractable.

For A. fulgidus proteins specifically, consider that crystallization at elevated temperatures (30-37°C) might better mimic the protein's native environment and potentially yield more physiologically relevant structures, though practical limitations may necessitate crystallization at standard temperatures with subsequent structural validation.

Finally, given the challenges often associated with crystallizing proteins from extremophiles, consider complementary structural approaches such as cryo-electron microscopy or small-angle X-ray scattering to obtain lower-resolution structural information if crystallization proves particularly challenging.

How should kinetic analyses be designed to elucidate CobS2 catalytic mechanisms?

Kinetic analysis of CobS2 requires careful experimental design that accounts for the enzyme's hyperthermophilic origin and the complex nature of cobalamin biosynthesis reactions. A methodologically sound approach should integrate multiple techniques to build a comprehensive understanding of the catalytic mechanism.

Table 4.2: Kinetic Analysis Framework for A. fulgidus CobS2

Kinetic ParameterExperimental ApproachAnalysis MethodExpected Insights
Initial ratesUV-Vis spectroscopy tracking substrate/product absorbance changesMichaelis-Menten analysisKm, Vmax, and kcat determination
Reaction orderVarying substrate and enzyme concentrationsDouble-logarithmic plotsIdentification of rate-limiting steps
Temperature dependenceActivity measurements across 50-90°C rangeArrhenius plotsActivation energy calculation
pH dependenceActivity profiles across pH 5-9pH-rate profilesIdentification of catalytic residues
Isotope effectsReactions with isotopically labeled substratesKinetic isotope effect analysisBond-making/breaking in transition state
Inhibition patternsActivity with structural analogs of substrates/productsDixon and Cornish-Bowden plotsBinding order and mechanism classification

When designing kinetic experiments for hyperthermophilic enzymes like those from A. fulgidus , several methodological considerations are crucial:

  • Temperature control: Ensure precise temperature regulation throughout experiments, as small variations can significantly affect rates. Consider using mineral oil overlays to prevent evaporation during high-temperature incubations.

  • Assay timing: Reactions may proceed extremely rapidly at optimal temperatures, necessitating rapid sampling techniques or continuous assays with thermostable detection systems.

  • Buffer selection: Choose buffers with minimal temperature-dependent pH changes. Pre-equilibrate all solutions at the assay temperature before initiating reactions.

  • Structured experimental design: Apply the PICO framework to formulate precise questions about each kinetic parameter . For example:

    • Problem: Unknown temperature optima for CobS2

    • Intervention: Activity measurements across temperature range

    • Comparison: Relative activities at each temperature

    • Outcome: Temperature optimum and activation energy determination

Additionally, consider integrating structural information into your kinetic analysis. Cobalamin-dependent enzymes often undergo significant conformational changes during catalysis, as observed in methionine synthase . These conformational dynamics may impact kinetic parameters in ways that steady-state measurements alone cannot reveal. Therefore, complementing traditional kinetics with pre-steady-state approaches like stopped-flow spectroscopy could provide valuable insights into transient reaction steps.

What mutagenesis approaches should be used to identify catalytic residues in CobS2?

Identifying catalytic residues in CobS2 requires a strategic combination of computational prediction and experimental validation through site-directed mutagenesis. This approach is particularly important for enzymes from extremophiles like A. fulgidus, where catalytic mechanisms may include adaptations to high-temperature environments .

Table 4.3: Mutagenesis Strategy for Identifying Critical Residues in A. fulgidus CobS2

ApproachMethodologyTarget Selection CriteriaAnalytical Methods
Sequence conservation analysisMultiple sequence alignment of CobS homologsResidues conserved across domains of lifePhylogenetic tree construction, ConSurf analysis
Structure-based predictionHomology modeling based on related structuresResidues in proximity to predicted active siteIn silico docking, molecular dynamics simulations
Alanine scanningSystematic mutation of predicted catalytic residues to alanineConserved charged or polar residuesActivity assays, binding studies
Conservative substitutionsMutation to chemically similar residuesResidues with significant activity loss in alanine scanningDetailed kinetic analysis, thermostability assessment
Unnatural amino acid incorporationAmber suppression technologyResidues requiring precise probing of electronic or steric effectsPre-steady-state kinetics, spectroscopic analysis
Histidine coordination analysisMutation of potential cobalt-coordinating histidinesResidues analogous to His761 in methionine synthase UV-Vis spectroscopy, EPR studies of cobalt coordination

When designing a mutagenesis strategy, prioritize residues based on their potential roles in:

  • Cobalamin binding and coordination (potentially including a critical histidine residue similar to His761 in methionine synthase )

  • Substrate binding and orientation

  • Catalytic chemistry (acid-base catalysis, nucleophilic attack)

  • Conformational changes necessary for catalysis

For hyperthermophilic enzymes like those from A. fulgidus, it's also important to distinguish between residues involved in thermostability and those essential for catalysis. This can be achieved by measuring both activity and thermostability for each mutant, creating a comprehensive profile of residue contributions to different aspects of enzyme function.

Design your mutagenesis experiments using the PICO framework to formulate precise questions :

  • Problem: Unknown role of specific residue X

  • Intervention: Site-directed mutagenesis of residue X to alanine

  • Comparison: Activity relative to wild-type enzyme

  • Outcome: Determination of residue X's contribution to catalysis

When analyzing mutant enzymes, employ multiple activity assays and biophysical techniques to develop a comprehensive understanding of each residue's contribution to catalysis, substrate binding, and protein stability.

What bioinformatic approaches reveal evolutionary insights about CobS2 in extremophiles?

Bioinformatic analysis of CobS2 can provide valuable insights into its evolution and adaptation in extremophiles like A. fulgidus. A comprehensive analytical framework combining sequence, structure, and genomic approaches will help reveal how this enzyme has adapted to extreme conditions while maintaining its essential catalytic function.

Table 4.4: Bioinformatic Framework for Evolutionary Analysis of CobS2

Analysis TypeMethodologyTools/DatabasesExpected Insights
Phylogenetic analysisMaximum likelihood tree constructionMEGA, RAxML, MrBayesEvolutionary relationships among CobS homologs
Sequence conservation mappingMultiple sequence alignment with conservation scoringConSurf, Clustal OmegaIdentification of universally conserved vs. extremophile-specific residues
Genomic context analysisExamination of gene neighborhoods across speciesIMG/M, KEGG, STRINGCo-evolution with other cobalamin biosynthesis genes
Adaptive evolution detectionSelection pressure analysis (dN/dS ratios)PAML, HyPhyIdentification of positively selected residues in extremophiles
Domain architecture comparisonIdentification of domain organization differencesPfam, InterPro, SMARTPotential adaptations in domain structure or linker regions
Horizontal gene transfer assessmentAnomalous GC content, codon usage analysisIslandViewer, Alien_HunterPotential acquisition of cobS2 through horizontal transfer
Structural bioinformaticsHomology modeling with thermostability predictionI-TASSER, FoldX, ThermoMutIdentification of structural adaptations for thermostability

When conducting evolutionary analyses of enzymes from extremophiles like A. fulgidus, which grows optimally at 83°C and utilizes carbon monoxide as an energy source , several methodological considerations are important:

  • Reference selection: Include diverse references across all domains of life, with particular attention to other extremophiles with different adaptations (halophiles, acidophiles) to distinguish general extremophile adaptations from thermophile-specific ones.

  • Structural context: Map conservation data onto structural models to identify spatial clusters of conserved residues that might indicate functional sites versus thermostability adaptations.

  • Experimental validation design: Use bioinformatic predictions to design targeted mutations that can test hypotheses about evolutionary adaptations.

  • Metabolic context integration: Consider A. fulgidus' unique carbon monoxide metabolism when interpreting CobS2 evolution, as cobalamin-dependent enzymes may play roles in these distinctive metabolic pathways.

For cobalamin-related enzymes specifically, examine how the cobalamin-binding domain architecture compares across different organisms. In methionine synthase, the cobalamin-binding domain (Cob) and adjacent Cap domain work together to protect the reactive cofactor . Analyzing whether similar protective mechanisms exist in CobS2 across different extremophiles could reveal evolutionary strategies for cofactor protection in harsh environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.