Recombinant Archaeoglobus fulgidus Probable cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Archaeoglobus fulgidus CobD

The Recombinant Archaeoglobus fulgidus Probable cobalamin biosynthesis protein CobD (cobD) is a hyperthermophilic enzyme critical to the anaerobic biosynthesis of cobalamin (vitamin B₁₂) in Archaeoglobus fulgidus. This archaeon, a sulfate-reducing thermophile, employs a distinct pathway for cobalamin synthesis, diverging from oxygen-dependent pathways in other organisms . CobD is part of the cob gene cluster, which encodes enzymes for converting adenosylcobyric acid to adenosylcobalamin through sequential modifications .

Role in Anaerobic Cobalamin Biosynthesis

In the anaerobic pathway, cobalamin synthesis involves early cobalt insertion and distinct enzymatic steps compared to aerobic systems :

  1. Corrin Ring Synthesis: Cobalt is incorporated into sirohydrochlorin to form cobalt-precorrin intermediates .

  2. Adenosyl Ligand Addition: CobO attaches an adenosyl group to Co(I) in adenosylcobyric acid .

  3. Aminopropanol Sidechain Attachment: CobD (or analogous enzymes) facilitates the addition of (R)-1-amino-2-propanol to the D-ring carboxylate, forming adenosylcobinamide phosphate .

CobD’s activity is inferred from its homology to cob operon proteins in A. fulgidus, which share conserved motifs for substrate binding and catalysis .

Recombinant Expression and Purification

CobD is expressed as a soluble fusion protein in E. coli, enabling large-scale production for structural or enzymatic studies . Key experimental insights:

  • Purification: Ni²⁺-NTA chromatography exploits the His-tag for high-yield recovery.

  • Stability: Tolerates mesophilic conditions during purification but retains thermostable properties from its native A. fulgidus origin .

Functional Hypothesis

While direct enzymatic assays for CobD are not reported in public literature, its role is hypothesized based on:

  • Genomic Context: Proximity to cobS2 (cobalamin synthase) in A. fulgidus suggests involvement in nucleotide loop assembly or phosphate group removal .

  • Homology: Structural similarity to CbiB, which catalyzes aminopropanol attachment in other anaerobes .

Biotechnological Relevance

CobD is a valuable tool for:

  • Cobalamin Production: Engineering A. fulgidus or heterologous hosts (e.g., E. coli) for industrial-scale vitamin B₁₂ synthesis.

  • Enzyme Mechanism Studies: Elucidating conserved catalytic strategies in archaeal vs. bacterial cobalamin pathways .

Comparative Insights

A comparison of key cobalamin biosynthesis enzymes in A. fulgidus highlights CobD’s niche:

EnzymeFunctionGenomic Context
CbiX(S)Cobalt chelatase (early step)af0721 (small size)
CobDAminopropanol attachment (late step)cobD (full-length)
CobS2Corrinoid reductasecobS2 (231 aa)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobD; AF_1336; Probable cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
cobD
Target Protein Sequence
MGIEVVVLLTTLMLDAAVGEPPALLHPVVWYGKLISLLERAKFRKMLVEIFYGAFCCLIV ITFALILSLLPFPYPLNFLWAVYLLFSSISVKSMVNHARVCVESGVDRKAVQMIVSRNTE ELSEEQLCSAVIESVAENYVDGVVAPLFYFSIFGVAGAVVYRAVNTCDAMVGYRKGRYEA FGKFAARLDDILNYIPARLSLLFFELLKRGAFSYGLKRNVKLNGCAIAAMSYLLGVKLEK PGYYSLPGIEPSAADIERAIKAFVRLTVIAVIFTTIAVSIRIVLLTKLHF
Uniprot No.

Target Background

Function
This protein catalyzes the conversion of cobyric acid to cobinamide by attaching aminopropanol to the F carboxylic group.
Database Links

KEGG: afu:AF_1336

STRING: 224325.AF1336

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant for cobalamin biosynthesis studies?

Archaeoglobus fulgidus is a hyperthermophilic, sulphate reducing, obligate anaerobe that belongs to the domain Archaea . This organism is particularly significant for studying cobalamin biosynthesis because it represents an archaeal model for investigating the anaerobic pathway of vitamin B12 synthesis. A. fulgidus grows optimally at 83°C with a growth range between 60°C and 95°C, making its proteins, including those involved in cobalamin biosynthesis, highly thermostable and potentially valuable for biotechnological applications . Its genome has been fully sequenced, allowing for comprehensive studies of its metabolic pathways, including those involved in cobalamin synthesis.

How does cobalamin biosynthesis differ between aerobic and anaerobic pathways?

Cobalamin biosynthesis occurs through two distinct pathways - aerobic and anaerobic - which differ primarily in the timing of cobalt insertion and the method of ring contraction . In the aerobic pathway, exemplified by Pseudomonas denitrificans, cobalt is inserted at a late stage, and molecular oxygen mediates the ring shrinkage process . Conversely, in the anaerobic route used by organisms like Salmonella enterica and potentially A. fulgidus, cobalt is inserted at an early stage, and ring contraction occurs through an oxygen-independent mechanism .

Despite these differences, both pathways share similarities in the peripheral modifications to the corrin molecule, including methylation, decarboxylation, and amidation, which occur in the same temporal and spatial orders . The transformation of cobalt-sirohydrochlorin into cobyric acid requires approximately 10 gene products in the anaerobic pathway, with many enzyme functions initially inferred from sequence comparisons to counterparts in the aerobic pathway .

What are the optimal conditions for expressing recombinant A. fulgidus CobD in E. coli?

For optimal expression of recombinant A. fulgidus CobD in E. coli, a methodological approach similar to that used for other A. fulgidus proteins can be applied . Based on successful expression of other A. fulgidus proteins, recommended conditions include:

  • Expression system: pET expression vectors (particularly pET-28a) with a 6×His-tag for purification

  • Host strain: E. coli BL21(DE3) or Rosetta(DE3) for rare codon optimization

  • Induction conditions: 0.5-1.0 mM IPTG when culture reaches OD600 of 0.6-0.8

  • Post-induction temperature: 30°C for 4-6 hours or 18°C overnight to enhance protein folding

  • Media supplementation: Consider adding 0.1-0.2 mM cobalt chloride to the medium since CobD is involved in cobalamin biosynthesis

The hyperthermophilic nature of A. fulgidus proteins often results in inclusion body formation when expressed in E. coli at higher temperatures, so lower induction temperatures are recommended to promote proper folding.

What purification strategy is most effective for isolating recombinant A. fulgidus CobD?

An effective purification strategy for recombinant A. fulgidus CobD would follow a multi-step approach:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin if the protein contains a His-tag

  • Heat treatment: Incubation at 70-75°C for 15-20 minutes to exploit the thermostable nature of A. fulgidus proteins and remove E. coli proteins

  • Ion exchange chromatography: Using either anion or cation exchange depending on the theoretical pI of CobD

  • Size exclusion chromatography: As a final polishing step to remove aggregates and obtain homogeneous protein

Throughout purification, buffer conditions should include:

  • 50 mM Tris-HCl or HEPES buffer (pH 7.5-8.0)

  • 100-300 mM NaCl to maintain solubility

  • 1-5 mM DTT or β-mercaptoethanol to prevent oxidation

  • Consider adding 10% glycerol for stability

This strategy leverages the thermostable nature of A. fulgidus proteins to achieve high purity through selective denaturation of E. coli host proteins.

How can the enzymatic activity of recombinant A. fulgidus CobD be assayed?

To assay the enzymatic activity of recombinant A. fulgidus CobD, researchers should set up a reaction monitoring the decarboxylation of L-threonine-O-3-phosphate to (R)-1-aminopropan-2-ol O-phosphate. A suitable methodology would include:

  • Direct assay approach:

    • Incubate purified CobD with L-threonine-O-3-phosphate substrate

    • Monitor CO2 release using a coupled enzymatic system or radioactive substrate

    • Reaction conditions: 50-100 mM buffer (HEPES pH 7.5-8.0), 75-83°C (optimum growth temperature of A. fulgidus), presence of pyridoxal phosphate (PLP) as a cofactor

  • Complementation assay approach:

    • Similar to studies with M. mazei CobZ in S. enterica, test whether A. fulgidus CobD can complement cobD mutations in other organisms

    • Introduce the A. fulgidus cobD gene into a cobD-deficient strain and assess restoration of cobalamin biosynthesis

    • Measure cobalamin production using bioassays with indicator strains requiring cobalamin for growth

  • HPLC/LC-MS based approach:

    • Analyze reaction products by HPLC or LC-MS to directly quantify the conversion of substrate to product

    • This method allows precise determination of kinetic parameters (KM, kcat, etc.)

Each approach has advantages for different research questions, with the direct assay being most suitable for biochemical characterization and the complementation assay most useful for confirming functional conservation.

What structural features are predicted for A. fulgidus CobD and how do they relate to function?

A. fulgidus CobD likely belongs to the fold-type II group of PLP-dependent enzymes, similar to other characterized CobD proteins. While specific structural data for A. fulgidus CobD is not directly available in the search results, structural predictions would include:

  • PLP-binding domain: A conserved lysine residue that forms a Schiff base with the PLP cofactor

  • Substrate-binding pocket: Shaped to accommodate L-threonine-O-3-phosphate

  • Thermostability features: Increased number of salt bridges, tighter hydrophobic packing, and reduced surface loops compared to mesophilic homologs

  • Oligomeric state: Likely forms homodimers or homotetramers, as is common for PLP-dependent enzymes

The relationship between structure and function would involve the PLP cofactor positioning the substrate for optimal decarboxylation chemistry while maintaining stability at the high temperatures (83°C) where A. fulgidus thrives .

How does temperature affect the activity and stability of A. fulgidus CobD?

A. fulgidus grows optimally at 83°C with a growth range of 60-95°C, suggesting its CobD protein would exhibit thermostability and thermoactivity profiles aligned with these temperatures . Expected thermal characteristics would include:

  • Thermal stability: Half-life at temperatures above 80°C likely exceeds several hours

  • Temperature optimum: Enzymatic activity would likely peak around 80-85°C, corresponding to the optimal growth temperature of A. fulgidus

  • Activity at lower temperatures: Reduced but potentially measurable activity at temperatures as low as 50-60°C

  • Unfolding temperature (Tm): Likely above 90°C, as measured by differential scanning calorimetry or thermal shift assays

Studies of the heat shock response in A. fulgidus have shown that approximately 14% of the genome (including many metabolic enzymes) exhibits differential expression in response to temperature shifts, suggesting complex adaptation mechanisms to temperature fluctuations . This knowledge should be considered when designing experimental conditions for CobD activity assays.

What comparative analyses between A. fulgidus CobD and homologous proteins from other organisms have been performed?

Comparative analyses of cobalamin biosynthesis proteins across different species have revealed important evolutionary and functional relationships that could apply to A. fulgidus CobD:

OrganismPathway TypeKey DifferencesSequence Similarity to A. fulgidus CobD
Salmonella entericaAnaerobicComplete de novo synthesisModerate similarity expected
Escherichia coliAnaerobic (incomplete)Cannot synthesize corrin ring de novoModerate similarity expected
Methanosarcina mazeiAnaerobicContains CobZ that can complement CobC function in S. entericaPotential functional overlap
Pseudomonas denitrificansAerobicDifferent timing of cobalt insertionLower similarity expected

While the provided search results don't document specific comparisons involving A. fulgidus CobD, the relationship between anaerobic and aerobic pathways has been characterized . The anaerobic pathway employed by A. fulgidus likely shares more similarities with that of S. enterica than with the aerobic pathway of P. denitrificans.

How does the gene expression of cobD in A. fulgidus respond to environmental stressors?

Based on whole-genome microarray studies of A. fulgidus heat shock response, approximately 14% of the genome shows altered expression during temperature shifts . While the search results don't specifically mention cobD expression patterns, the regulation of metabolic genes in A. fulgidus follows these general trends:

  • Heat shock response: Many metabolic genes show either increased (189 ORFs) or decreased (161 ORFs) expression following temperature shift from 78°C to 89°C

  • Temporal patterns: Expression changes occur rapidly (within 5 minutes) after temperature shift and generally persist for at least 60 minutes

  • Functional categories: Genes involved in "energy production and conservation" are among the most frequently affected by heat shock

For investigating cobD regulation specifically, researchers should design real-time RT-PCR experiments similar to those used to validate other A. fulgidus heat shock genes, where the correlation between microarray and RT-PCR data was strong (R = 0.944) .

What are the challenges in determining the precise biochemical role of CobD in the archaeal cobalamin biosynthesis pathway?

Determining the precise biochemical role of CobD in archaeal cobalamin biosynthesis faces several challenges:

  • Pathway variations: Significant differences exist between aerobic and anaerobic cobalamin biosynthesis pathways, requiring careful delineation of the specific route used by A. fulgidus

  • Functional redundancy: Some archaeal genomes contain redundant functions for cobalamin biosynthesis, as observed in Halobacterium sp. where deletion of certain genes showed no discernible phenotype

  • Oxygen sensitivity: The anaerobic pathway may involve oxygen-labile intermediates or enzymes, complicating biochemical analyses

  • Limited genetic tools: While genetic systems exist for some archaea, manipulation of A. fulgidus genes presents technical challenges

  • Hyperthermophilic conditions: Assaying enzyme activities at the high temperatures required for A. fulgidus proteins (optimally 83°C) requires specialized equipment and approaches

Addressing these challenges requires a combination of biochemical, genetic, and structural approaches, potentially including heterologous complementation studies and in vitro reconstitution of pathway segments.

How might recombinant A. fulgidus CobD be engineered for enhanced thermostability or catalytic efficiency?

Engineering recombinant A. fulgidus CobD for enhanced properties could follow several strategies:

  • Rational design approaches:

    • Introduce additional salt bridges or disulfide bonds to enhance thermostability

    • Modify substrate binding residues based on structural models to improve specificity or catalytic rate

    • Reduce surface loop flexibility through proline substitutions or loop shortening

  • Directed evolution strategies:

    • Develop a high-throughput screening method for CobD activity

    • Apply error-prone PCR or DNA shuffling to generate variant libraries

    • Screen for variants with improved activity at target temperatures

  • Computational design approaches:

    • Use molecular dynamics simulations to identify flexible regions that might limit thermostability

    • Apply computational protein design algorithms to suggest stabilizing mutations

    • Model substrate-enzyme interactions to identify potential catalytic enhancements

When engineering thermostable enzymes like those from A. fulgidus, researchers often face trade-offs between stability and activity that must be carefully balanced. The naturally high thermostability of A. fulgidus CobD makes it an excellent starting point for engineering efforts aimed at extreme conditions.

How do archaeal cobalamin biosynthesis pathways differ from those in bacteria?

Archaeal cobalamin biosynthesis pathways show both similarities and differences compared to their bacterial counterparts:

  • Pathway organization:

    • Archaeal genomes like A. fulgidus often contain fewer genes for cobalamin biosynthesis than bacteria

    • Some archaea contain only one or two Orc/Cdc6 homologues compared to multiple copies in bacteria

  • Regulatory mechanisms:

    • Archaeal heat shock regulation involves proteins like HSR1 in A. fulgidus, which are only distantly related to bacterial regulators

    • Gene regulation may involve archaeal-specific transcription factors and promoter elements

  • Unique proteins:

    • Some archaea contain unique cobamide biosynthesis proteins not found in bacteria

    • For example, the CobZ protein in M. mazei can functionally complement the bacterial CobC protein, suggesting evolutionary divergence in pathway components

  • Adaptations to extreme environments:

    • Archaeal cobalamin biosynthesis proteins from hyperthermophiles like A. fulgidus must function at temperatures (83°C optimal) that would denature most bacterial enzymes

    • These adaptations may include structural modifications to improve thermostability while maintaining catalytic function

Understanding these differences provides insight into the evolution of this complex biosynthetic pathway across domains of life.

What are the experimental approaches for investigating protein-protein interactions involving A. fulgidus CobD?

Investigating protein-protein interactions involving A. fulgidus CobD requires approaches tailored to thermophilic proteins:

  • Pull-down assays:

    • Express tagged CobD in E. coli

    • Perform pull-down experiments under conditions mimicking the physiological environment of A. fulgidus (high temperature, appropriate salt concentration)

    • Identify interacting partners by mass spectrometry

    • Verify interactions with purified recombinant proteins

  • Bacterial/yeast two-hybrid systems:

    • Adapt traditional two-hybrid systems for thermophilic proteins

    • Use heat-shock induction to ensure proper folding of A. fulgidus proteins

    • Screen for interactions with other cobalamin biosynthesis proteins

  • Surface plasmon resonance (SPR):

    • Immobilize purified CobD on a sensor chip

    • Flow potential interacting proteins over the surface

    • Measure binding kinetics at elevated temperatures to mimic physiological conditions

  • Crosslinking studies:

    • Use chemical crosslinkers to capture transient interactions in vivo or in vitro

    • Analyze crosslinked complexes by SDS-PAGE and mass spectrometry

    • Focus on interactions with other proteins involved in cobalamin biosynthesis

These approaches should be implemented considering the high optimal growth temperature of A. fulgidus (83°C) , which may necessitate adaptations to standard protocols.

How does the function of A. fulgidus CobD relate to the broader metabolism and ecological niche of this organism?

A. fulgidus CobD's function in cobalamin biosynthesis connects to the organism's broader metabolism and ecological niche in several ways:

  • Anaerobic energy metabolism:

    • As a hyperthermophilic, sulphate-reducing, obligate anaerobe, A. fulgidus requires cobalamin-dependent enzymes for several metabolic pathways

    • Cobalamin-dependent methyltransferases are critical for anaerobic carbon metabolism and energy generation

  • Adaptation to extreme environments:

    • The ability to synthesize cobalamin at high temperatures (optimal growth at 83°C) represents an adaptation to hydrothermal environments

    • Cobalamin biosynthesis proteins, including CobD, must maintain activity under these extreme conditions

  • Evolutionary considerations:

    • A. fulgidus possesses archaeal-specific features in its metabolic pathways, including cobalamin biosynthesis

    • The presence of complete cobalamin biosynthesis genes suggests this capability provides a selective advantage in its ecological niche

  • Metabolic integration:

    • Cobalamin biosynthesis intersects with other metabolic pathways, including siroheme synthesis and heme synthesis, as observed in other organisms

    • At the uro'gen III stage, these pathways diverge, allowing the organism to allocate resources between different tetrapyrrole-derived cofactors

Understanding CobD's role within this context helps explain how A. fulgidus has adapted to its unique ecological niche in high-temperature, anaerobic environments.

What are the most promising future research directions for A. fulgidus CobD?

Future research on A. fulgidus CobD could productively focus on several areas:

  • Structural characterization:

    • Determine the crystal structure of A. fulgidus CobD to understand its thermostability mechanisms

    • Compare with mesophilic homologs to identify key structural adaptations

  • Functional investigations:

    • Develop genetic tools for A. fulgidus to create knockout strains

    • Establish the precise role of CobD in the context of the complete cobalamin biosynthesis pathway

    • Investigate potential additional functions beyond the predicted L-threonine-O-3-phosphate decarboxylase activity

  • Regulatory networks:

    • Study how cobD expression is regulated in response to environmental factors

    • Identify transcription factors controlling cobD expression

    • Integrate findings with whole-genome expression studies of A. fulgidus under various conditions

  • Biotechnological applications:

    • Explore the potential of A. fulgidus CobD for thermostable biocatalysis applications

    • Investigate whether its thermostability features can be transferred to other enzymes

These research directions would advance our understanding of both fundamental archaeal biochemistry and potential biotechnological applications of thermostable proteins.

What are the implications of understanding archaeal cobalamin biosynthesis for evolutionary biology?

Understanding archaeal cobalamin biosynthesis, including the role of proteins like A. fulgidus CobD, has significant implications for evolutionary biology:

  • Ancient metabolic pathway evolution:

    • Cobalamin is an ancient cofactor, and its biosynthesis pathway provides insights into early metabolic evolution

    • The differences between archaeal and bacterial pathways illuminate domain-specific adaptations

  • Horizontal gene transfer:

    • Comparison of cobalamin biosynthesis genes across domains may reveal instances of horizontal gene transfer

    • The presence of proteins like CobZ in M. mazei that can complement bacterial functions suggests possible evolutionary exchanges

  • Adaptation to extreme environments:

    • Understanding how A. fulgidus cobalamin biosynthesis proteins function at high temperatures provides insights into molecular adaptation strategies

    • These adaptations represent evolutionary solutions to the challenges posed by extreme environments

  • Metabolic pathway diversification:

    • The existence of both aerobic and anaerobic pathways for cobalamin biosynthesis demonstrates how core metabolic pathways can diverge while maintaining the same end product

    • This diversification exemplifies how evolution can produce multiple solutions to the same biochemical challenge

The continued study of archaeal cobalamin biosynthesis will deepen our understanding of the evolution of complex metabolic pathways across the tree of life.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.