Recombinant Archaeoglobus fulgidus Uncharacterized MscS family protein AF_1546 (AF_1546)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_1546; Uncharacterized MscS family protein AF_1546
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1546
Target Protein Sequence
MGIMIDVLNYKLYGDVTVYDIIVVIVVMALATIIAKLITTNLRRALIDKMKRDQLELMLK VIYFGIIIVAFIAVLPALGLDLSGLLVAGGITGIVLGFASQSVVANLVSGIFLISEKPIK IGDQVNIDGVAGFVEDVNILSTIIRTYDGLYVRIPNEKVFTSNITNYVAHIARRFEYVVG IRYSDDAEKAIEIIKRIIEEHPFALKNPEPVVFVDNLGDSSVNIVVRIWAPSTEWYNVKM ELLWKIKTELEKNGIEIPFPQRVVWFANELRANVEGKEERRQA
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1546

STRING: 224325.AF1546

Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is AF_1546 and what organism does it originate from?

AF_1546 is an uncharacterized protein belonging to the MscS (Mechanosensitive channel of Small conductance) family from the hyperthermophilic, sulphate-reducing archaeon Archaeoglobus fulgidus. A. fulgidus was the first sulphur-metabolizing organism to have its genome sequence determined, with a genome of 2,178,400 base pairs containing 2,436 open reading frames (ORFs) . AF_1546 represents one of many functionally uncharacterized yet conserved proteins in the A. fulgidus genome, which constitutes approximately a quarter (651 ORFs) of its total genetic material .

What is the significance of studying proteins from Archaeoglobus fulgidus?

Studying proteins from A. fulgidus provides unique insights into molecular adaptations to extreme environments, as this organism grows optimally at temperatures around 83°C and can survive in high-pressure, high-temperature conditions. Research on A. fulgidus proteins contributes to understanding archaeal biology, evolutionary relationships among domains of life, and potential biotechnological applications of thermostable proteins. Specifically, the heat shock response of A. fulgidus has been studied using whole-genome microarrays, revealing that approximately 350 of the 2,410 ORFs (about 14%) exhibited increased or decreased transcript abundance during heat shock . These genes span various cellular functions including energy production, amino acid metabolism, and signal transduction.

What information is available about the recombinant form of AF_1546?

The recombinant form of AF_1546 has been successfully expressed with an N-terminal His-tag in E. coli . The table below summarizes the key properties of the recombinant protein:

PropertyDetails
Catalog NumberRFL36154AF
Source (Host)E. coli
SpeciesArchaeoglobus fulgidus
TagHis
Protein LengthFull Length (1-283)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
UniProt IDO28726

What expression systems are recommended for recombinant production of AF_1546?

Based on available research, E. coli has been successfully used as an expression host for AF_1546 . For membrane proteins like AF_1546, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may improve yields. The methodological approach typically involves:

  • Cloning the AF_1546 gene into an expression vector with an N-terminal His-tag

  • Transforming the construct into an appropriate E. coli strain

  • Growing the culture until optimal density (typically when OD600 reaches 0.8)

  • Inducing protein expression at lower temperatures (16-20°C) to enhance proper folding

  • Harvesting cells and proceeding with purification

For thermophilic archaeal proteins like AF_1546, codon optimization for E. coli expression may be beneficial to overcome potential codon bias issues.

What purification protocol would you recommend for recombinant AF_1546?

A recommended purification protocol for His-tagged recombinant AF_1546 would include:

  • Cell lysis by sonication in buffer containing 50 mM Tris, 500 mM NaCl at pH 8.0

  • Clarification of the lysate by centrifugation to remove cell debris

  • Affinity purification using Ni-NTA column chromatography according to manufacturer's instructions

  • Washing the column with buffer containing low concentrations of imidazole to remove nonspecifically bound proteins

  • Elution of the target protein with buffer containing higher concentrations of imidazole

  • Buffer exchange to remove imidazole, typically using dialysis

  • Concentration of the purified protein and analysis by SDS-PAGE to confirm purity

The purified protein can then be lyophilized for long-term storage or used directly for functional studies.

What are the optimal storage conditions for maintaining AF_1546 stability?

For optimal stability, recombinant AF_1546 should be stored according to these guidelines :

  • Store at -20°C/-80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For reconstitution of lyophilized protein:

    • Centrifuge the vial briefly to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is the default recommendation)

    • Aliquot for long-term storage at -20°C/-80°C

How can researchers determine the structure of AF_1546?

Determining the structure of membrane proteins like AF_1546 presents unique challenges due to their hydrophobic nature and requirement for a lipid environment. A comprehensive approach might include:

  • Computational Prediction: Initial structural models can be generated using homology modeling based on structurally characterized MscS family members or using AI-based structure prediction tools like AlphaFold.

  • X-ray Crystallography: This would require:

    • Large-scale expression and purification of AF_1546

    • Protein stabilization in detergent micelles or lipidic cubic phases

    • Screening for crystallization conditions

    • Data collection at synchrotron facilities

    • Structure determination and refinement

  • Cryo-Electron Microscopy (cryo-EM): Increasingly the method of choice for membrane proteins:

    • Reconstitution of AF_1546 into nanodiscs or liposomes

    • Vitrification of samples

    • High-resolution imaging

    • Single-particle analysis and 3D reconstruction

  • NMR Spectroscopy: Suitable for specific domains or smaller proteins:

    • Isotopic labeling (15N, 13C) of recombinant AF_1546

    • Preparation in membrane-mimetic environments

    • Acquisition of multi-dimensional NMR spectra

    • Structure calculation based on distance and angular constraints

What approaches can be used to investigate the channel properties of AF_1546?

As a putative mechanosensitive channel, several electrophysiological and biophysical techniques can characterize AF_1546's functional properties:

  • Planar Lipid Bilayer Electrophysiology:

    • Reconstitute purified AF_1546 into planar lipid bilayers

    • Apply voltage across the membrane and measure current

    • Apply membrane tension through hydrostatic pressure or osmotic gradients

    • Characterize channel conductance, ion selectivity, and gating properties

  • Patch-Clamp Analysis:

    • Express AF_1546 in suitable host cells (e.g., giant E. coli spheroplasts)

    • Use patch-clamp techniques to measure single-channel activity

    • Assess response to membrane tension through application of negative pressure

  • Fluorescence-Based Flux Assays:

    • Reconstitute AF_1546 into liposomes containing fluorescent dyes sensitive to specific ions

    • Monitor changes in fluorescence upon application of osmotic shock

    • Quantify channel activity in response to different stimuli

  • Molecular Dynamics Simulations:

    • Build computational models of AF_1546

    • Simulate protein behavior in a lipid bilayer under varying conditions

    • Analyze conformational changes and ion permeation pathways

How can researchers investigate AF_1546's role in the heat shock response of A. fulgidus?

While specific information about AF_1546's involvement in heat shock response is not directly provided in the search results, researchers could design experiments based on what is known about A. fulgidus heat shock systems :

  • Transcriptomic Analysis:

    • Expose A. fulgidus cultures to heat shock (e.g., temperature shift from 78°C to 89°C)

    • Extract RNA at various time points

    • Perform RNA-seq or microarray analysis to determine if AF_1546 expression changes

    • Compare with known heat shock genes such as AF1298, AF1297, and AF1296

  • Protein Expression Analysis:

    • Generate antibodies against recombinant AF_1546

    • Perform Western blot analysis of A. fulgidus lysates before and after heat shock

    • Quantify changes in AF_1546 protein levels

  • Promoter Analysis:

    • Identify the promoter region of AF_1546

    • Look for binding sites of known heat shock regulators like HSR1 (encoded by AF1298)

    • Perform EMSA or DNase I footprinting assays to identify proteins that bind to the AF_1546 promoter

  • Genetic Studies:

    • Develop methods to overexpress or knock down AF_1546 in A. fulgidus

    • Assess the impact on cell survival under heat shock conditions

    • Measure changes in membrane permeability and ion homeostasis

What methodological approaches can resolve contradictory functional data for MscS family proteins?

Researchers working with MscS family proteins like AF_1546 may encounter contradictory functional data due to differences in experimental conditions or protein preparation. To resolve such contradictions:

  • Standardized Expression and Purification:

    • Implement consistent protocols for protein expression and purification

    • Characterize protein purity, homogeneity, and oligomeric state using techniques like SEC-MALS

    • Verify protein folding using circular dichroism spectroscopy

  • Multiple Functional Assays:

    • Apply complementary techniques (electrophysiology, flux assays, osmotic shock survival)

    • Compare results across different membrane environments (native lipids vs. synthetic lipids)

    • Test function at different temperatures relevant to A. fulgidus physiology

  • Mutagenesis Studies:

    • Generate targeted mutations in key functional residues identified through sequence alignment with characterized MscS proteins

    • Assess the impact of mutations on channel function

    • Use the results to build a consistent functional model

  • Reconstitution in Native-like Environments:

    • Extract lipids from A. fulgidus membranes

    • Reconstitute AF_1546 in these native lipids

    • Compare functional properties with reconstitution in standard lipids

  • Cross-Laboratory Validation:

    • Establish collaborations for independent verification of key findings

    • Use identical protein preparations and experimental conditions

    • Develop standardized protocols for the research community

How does AF_1546 compare to other characterized MscS family proteins?

A detailed comparative analysis of AF_1546 with other MscS family proteins would include:

  • Sequence Comparison:

    • Perform multiple sequence alignments with well-characterized MscS proteins

    • Identify conserved functional domains and unique features of AF_1546

    • Construct phylogenetic trees to understand evolutionary relationships

  • Structural Comparison:

    • Compare predicted or determined structures

    • Analyze transmembrane topology and pore-forming regions

    • Identify potential structural adaptations to high temperature

  • Functional Comparison:

    • Compare electrophysiological properties (conductance, ion selectivity, voltage dependence)

    • Assess sensitivity to membrane tension

    • Evaluate gating kinetics and adaptation behaviors

  • Thermostability Analysis:

    • Compare thermal denaturation profiles of AF_1546 with mesophilic MscS proteins

    • Identify structural features contributing to enhanced thermostability

    • Assess functional activity at different temperatures

What insights can be gained from studying AF_1546 in the context of extremophile adaptation?

Studying AF_1546 can provide valuable insights into how mechanosensitive channels adapt to extreme environments:

  • Membrane-Protein Interactions in Extremophiles:

    • Investigate how AF_1546 interacts with archaeal lipids, which differ significantly from bacterial or eukaryotic lipids

    • Determine how these interactions contribute to protein stability and function at high temperatures

    • Assess the impact of membrane fluidity on channel gating at different temperatures

  • Evolutionary Adaptations:

    • Identify unique sequence and structural features that distinguish AF_1546 from mesophilic homologs

    • Determine whether these features represent convergent or divergent evolution

    • Understand how selective pressures in extreme environments shape protein function

  • Functional Plasticity:

    • Investigate whether AF_1546 exhibits broader or narrower functionality compared to mesophilic homologs

    • Determine if it has acquired novel functions beyond osmotic regulation

    • Assess its role in other stress responses relevant to A. fulgidus ecology

  • Biotechnological Applications:

    • Explore potential applications of thermostable channel proteins in biosensors or controlled-release systems

    • Identify specific domains or features that could be incorporated into other proteins to enhance thermostability

What is the recommended protocol for reconstituting AF_1546 into liposomes for functional studies?

For functional reconstitution of AF_1546 into liposomes, the following detailed protocol is recommended:

  • Preparation of Lipid Mixture:

    • Select lipids that mimic archaeal membranes or are stable at high temperatures

    • Typically use a mixture of synthetic lipids such as DOPC, DOPE, and DOPG at a 7:2:1 ratio

    • Dissolve lipids in chloroform, dry under nitrogen, and further dry under vacuum

    • Rehydrate the lipid film in reconstitution buffer (e.g., 10 mM HEPES, 150 mM KCl, pH 7.4)

    • Subject to freeze-thaw cycles and extrusion through polycarbonate filters to form unilamellar vesicles

  • Protein Incorporation:

    • Add purified AF_1546 to the liposomes at protein-to-lipid ratios ranging from 1:100 to 1:1000 (w/w)

    • Add detergent (e.g., Triton X-100) to partially solubilize liposomes

    • Incubate at room temperature for 30 minutes with gentle agitation

    • Remove detergent using Bio-Beads or dialysis

    • For a thermophilic protein like AF_1546, perform key steps at elevated temperatures (30-40°C)

  • Verification of Reconstitution:

    • Analyze proteoliposomes by electron microscopy to confirm integrity

    • Perform sucrose gradient centrifugation to separate proteoliposomes from non-incorporated protein

    • Use freeze-fracture electron microscopy to visualize protein distribution within the membrane

    • Conduct functional assays to confirm channel activity

  • Functional Testing:

    • Perform ion flux assays using fluorescent dyes such as ACMA for proton flux or Fluo-4 for calcium

    • Apply osmotic shock by rapidly changing buffer tonicity

    • Monitor fluorescence changes that indicate channel opening in response to membrane tension

How can researchers assess the thermostability of recombinant AF_1546?

Given AF_1546's origin from a hyperthermophilic archaeon, assessing its thermostability is crucial. A comprehensive approach would include:

  • Differential Scanning Calorimetry (DSC):

    • Measure heat capacity of purified AF_1546 as a function of temperature

    • Determine the melting temperature (Tm) and enthalpy of unfolding

    • Compare thermodynamic parameters in different buffer conditions

    • For membrane proteins, perform measurements in detergent micelles or reconstituted in liposomes

  • Circular Dichroism (CD) Spectroscopy:

    • Record CD spectra at far-UV wavelengths (190-260 nm) to monitor secondary structure

    • Perform thermal melting experiments by monitoring CD signal at a fixed wavelength while increasing temperature

    • Calculate the midpoint of thermal denaturation (Tm)

    • Assess the reversibility of thermal unfolding by cooling and reheating

  • Intrinsic Fluorescence Spectroscopy:

    • Monitor changes in tryptophan fluorescence as temperature increases

    • Analyze spectral shifts that indicate changes in local environment of aromatic residues

    • Determine temperature-dependent unfolding transitions

  • Activity Assays at Different Temperatures:

    • Reconstitute AF_1546 into liposomes containing appropriate fluorescent dyes

    • Measure channel activity at temperatures ranging from room temperature to 90°C

    • Determine the temperature optimum and range for functional activity

    • Assess activity retention after exposure to different temperatures

  • Thermal Stability in Different Environments:

    • Compare stability in different detergents, lipids, and buffer compositions

    • Test the effect of osmolytes like trehalose or glycerol on thermal stability

    • Investigate the role of specific ions in stabilizing the protein structure

What emerging technologies could advance our understanding of AF_1546 function?

Several cutting-edge technologies offer promising avenues for deepening our understanding of AF_1546:

  • Cryo-Electron Tomography:

    • Visualize AF_1546 in situ within native-like membranes

    • Observe structural changes in response to membrane tension

    • Map spatial organization and interactions with other membrane components

  • Single-Molecule Force Spectroscopy:

    • Directly measure the forces required to gate the AF_1546 channel

    • Characterize energy landscapes of channel opening and closing

    • Determine how temperature affects the mechanical properties of the channel

  • Advanced Fluorescence Techniques:

    • Use FRET pairs to monitor conformational changes during gating

    • Apply single-molecule fluorescence to observe individual channel opening events

    • Implement high-speed fluorescence imaging to capture rapid gating kinetics

  • Optogenetic Control:

    • Engineer light-sensitive domains into AF_1546

    • Control channel activity with precise spatial and temporal resolution

    • Study channel function in reconstituted systems without mechanical perturbation

  • Nanopore Sequencing Adaptations:

    • Repurpose AF_1546 as a nanopore for single-molecule detection

    • Exploit its thermostability for high-temperature sensing applications

    • Develop hybrid systems combining biological and solid-state elements

How might studying AF_1546 contribute to understanding archaeal membrane biology?

Comprehensive study of AF_1546 can provide significant insights into archaeal membrane biology:

  • Membrane Adaptation to Extreme Environments:

    • Determine how archaeal membrane proteins maintain functionality at high temperatures

    • Understand protein-lipid interactions unique to archaeal membranes

    • Elucidate the role of mechanosensitive channels in stress responses specific to archaea

  • Evolutionary Implications:

    • Compare archaeal, bacterial, and eukaryotic mechanosensitive channels

    • Identify conserved functional mechanisms across domains of life

    • Trace the evolutionary history of osmotic regulation systems

  • Archaeal Membrane Dynamics:

    • Investigate how membrane tension is sensed and regulated in archaeal cells

    • Understand the interplay between membrane composition and protein function

    • Determine how cell shape and membrane properties are maintained in extreme environments

  • Biotechnological Applications:

    • Develop thermostable biosensors based on archaeal mechanosensitive channels

    • Design novel antimicrobials targeting archaeal-specific membrane features

    • Create bioinspired materials with enhanced stability and controlled permeability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.