Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0085 (AF_0085)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_0085; Uncharacterized protein AF_0085
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0085
Target Protein Sequence
MVARTIATFAGSTALTIKPFLVNLPVVICLAAYLVSQVFCLAGFCPDYLAELHLCTFFTF FTSFLLVPLAIFTLRKDGNFLRKRAVFTSYSCVYPPFRLGNPTCFYSYHWFLIHIPESLW LVNNGFGLRATCRLSSRRSQR
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0085

STRING: 224325.AF0085

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant in extremophile research?

Archaeoglobus fulgidus is a hyperthermophilic archaeon that serves as a model organism for studying adaptations to extreme environments. As described in recent studies, A. fulgidus strain VC-16 has been extensively characterized using whole-genome microarrays to understand its responses to environmental stressors, particularly heat shock . The organism's ability to thrive under high hydrostatic pressure and elevated temperatures makes it valuable for studying proteins that function under extreme conditions . When investigating AF_0085, it's essential to consider the organism's natural habitat and growth conditions, as these factors significantly influence protein structure and function.

How does AF_0085 compare structurally to other characterized proteins in A. fulgidus?

While AF_0085 remains uncharacterized, comparative analysis can be conducted using similar approaches to those applied to other A. fulgidus proteins. For instance, researchers have identified that AF1298 contains a putative helix-turn-helix DNA binding motif that plays a role in heat shock regulation . To analyze AF_0085, consider employing similar methodological approaches:

  • Perform amino acid BLAST searches against non-redundant databases

  • Align sequences with homologous proteins from other Archaea

  • Identify conserved domains and motifs

  • Compare N-terminal and C-terminal regions separately, as observed in other A. fulgidus proteins where functional domains may show variable conservation patterns

What expression systems are most effective for recombinant AF_0085 production?

Based on successful expression of other A. fulgidus proteins, two primary systems warrant consideration:

Baculovirus Expression System:
This system has been successfully employed for recombinant production of other A. fulgidus uncharacterized proteins such as AF_1681 . The baculovirus system is particularly valuable for proteins requiring eukaryotic post-translational modifications or when bacterial expression proves challenging.

E. coli Expression System:
E. coli has been successfully used to express and purify A. fulgidus proteins to homogeneity, as demonstrated with HSR1 (the AF1298 gene product) . This approach typically involves:

  • Cloning the target gene into an appropriate vector with a purification tag

  • Optimizing expression conditions (temperature, induction timing, media composition)

  • Developing a purification strategy typically involving affinity chromatography followed by additional polishing steps

When selecting an expression system, consider the predicted characteristics of AF_0085 and potential requirements for proper folding under extremophile conditions.

What purification challenges are commonly encountered with A. fulgidus recombinant proteins, and how can they be addressed?

Purification of hyperthermophilic archaeal proteins presents several methodological challenges:

ChallengeRecommended SolutionRationale
Improper folding at mesophilic temperaturesHeat treatment during purificationExploits thermostability to eliminate E. coli contaminants while promoting proper folding
Inclusion body formationSolubilization with mild detergents or arginineMaintains native-like structure during refolding
Low expression levelsCodon optimization for expression hostAddresses potential codon bias issues
Protein aggregationAddition of stabilizing agents (e.g., glycerol, specific salts)Mimics aspects of the native extremophile environment

The purification protocol should be systematically optimized through iterative testing of various buffer conditions and purification methods.

What experimental approaches can effectively determine the structure-function relationship of AF_0085?

A multi-technique approach is recommended:

  • X-ray Crystallography or Cryo-EM: These techniques can provide high-resolution structural information, revealing potential functional domains similar to the analysis that identified the helix-turn-helix motif in AF1298 .

  • Biophysical Characterization: Methods including circular dichroism, differential scanning calorimetry, and isothermal titration calorimetry can reveal thermodynamic properties particularly relevant to proteins from hyperthermophiles.

  • Functional Assays Based on Predicted Properties: If bioinformatic analysis suggests potential functions (DNA/RNA binding, enzymatic activity, protein-protein interactions), design specific assays to test these hypotheses.

  • Comparative Analysis with Known Domains: As demonstrated with HSR1's DNA binding properties assessment, electrophoresis mobility shift assays (EMSA) and DNase I footprinting can reveal DNA binding specificities if AF_0085 contains putative nucleic acid interaction domains .

How can transcriptomic and proteomic approaches help elucidate the physiological role of AF_0085?

Integrated omics approaches provide contextual information about when and where AF_0085 functions:

  • Transcriptomic Analysis: Whole-genome microarrays similar to those used to study A. fulgidus heat shock response can reveal whether AF_0085 expression changes under specific conditions . If AF_0085 shows differential expression patterns similar to the heat shock response genes (such as AF1298, AF1297, and AF1296), this may suggest involvement in stress adaptation.

  • Co-expression Network Analysis: Identify genes with similar expression patterns to AF_0085 to predict functional relationships and potential involvement in specific cellular processes.

  • Protein-Protein Interaction Studies: Employ pull-down assays, yeast two-hybrid, or proximity labeling approaches to identify interaction partners, potentially placing AF_0085 in a functional context.

  • Comparative Proteomics: Compare protein abundance across different growth conditions to identify correlations between AF_0085 levels and specific cellular states.

How might AF_0085 contribute to the extremophilic adaptations of A. fulgidus?

Investigation of AF_0085's role in extremophile adaptation should consider multiple aspects:

  • Thermal Stability Analysis: Determine if AF_0085 possesses unusual structural features contributing to thermostability, such as increased disulfide bonds, salt bridges, or hydrophobic interactions.

  • Pressure Adaptation Studies: Examine AF_0085 behavior under high hydrostatic pressure conditions, similar to the batch cultivation experiments conducted with A. fulgidus .

  • Comparative Genomics Across Extremophiles: Identify homologs in other extremophiles to determine if AF_0085 represents a conserved adaptation strategy.

  • Knockout/Knockdown Studies: If genetic manipulation systems are available for A. fulgidus, assess phenotypic changes when AF_0085 expression is altered under various stress conditions.

What is the potential evolutionary significance of uncharacterized proteins like AF_0085 in Archaea?

Evolutionary analysis of AF_0085 may reveal important insights:

  • Phylogenetic Distribution: Map the presence of AF_0085 homologs across archaeal lineages to determine if it represents an ancient or recently acquired gene.

  • Domain Architecture Analysis: Compare domain organization with distant homologs to identify functional innovations specific to extremophiles.

  • Horizontal Gene Transfer Assessment: Evaluate evidence for lateral acquisition from other extremophiles or bacteria sharing similar ecological niches.

  • Selection Pressure Analysis: Calculate nonsynonymous to synonymous substitution ratios to identify regions under purifying or positive selection.

What controls are essential when studying the biochemical properties of AF_0085?

Rigorous experimental design requires appropriate controls:

Control TypePurposeImplementation
Positive ControlValidate assay functionalityUse well-characterized A. fulgidus protein with similar properties (e.g., HSR1 for DNA binding studies)
Negative ControlEstablish background signalTest non-specific proteins from A. fulgidus or denatured AF_0085
Buffer ControlsAccount for effects of buffer componentsTest protein activity across different buffer compositions reflecting physiological conditions
Temperature ControlsAssess temperature-dependent functionalityCompare activity at standard lab conditions versus temperatures mimicking native environment
Substrate Specificity ControlsDetermine reaction selectivityTest multiple potential substrates when assessing enzymatic function

How should expression data for AF_0085 be analyzed and interpreted in the context of heat shock response?

Based on established methodologies used for heat shock gene analysis in A. fulgidus:

  • Time-Course Analysis: Monitor expression changes across multiple time points after stress induction, similar to the approach that revealed maximum expression of heat shock genes at 5 minutes post-induction followed by reduction over 55 minutes .

  • Quantitative Assessment: Calculate fold changes in mRNA levels, using significant thresholds similar to those applied to known heat shock genes (e.g., the threefold change criterion) .

  • Operon Structure Analysis: Determine if AF_0085 is part of an operon by examining intergenic spacers and presence of TATA or BRE boxes, similar to the analysis that revealed the operon structure of AF1298, AF1297, and AF1296 .

  • Binding Site Identification: If AF_0085 contains a DNA-binding domain, perform DNase I footprinting to identify potential binding motifs, as was done for HSR1 protein which revealed the palindromic motif CTAAC-N5-GTTAG .

How can researchers overcome solubility issues when working with recombinant AF_0085?

Solubility challenges are common with extremophile proteins expressed in mesophilic systems:

  • Expression Temperature Optimization: Test expression at elevated temperatures (30-42°C) to better mimic native conditions.

  • Fusion Tag Selection: Systematically test multiple solubility-enhancing tags (MBP, SUMO, thioredoxin) to identify optimal construct design.

  • Co-expression with Chaperones: Consider co-expressing with archaeal chaperones or heat shock proteins like those encoded by AF1451 (thermosome beta subunit) or AF2238 (thermosome alpha subunit) .

  • Refolding Strategies: Develop stepwise refolding protocols that gradually introduce conditions resembling the native environment of A. fulgidus.

What methodological approaches can accurately assess DNA-binding properties if AF_0085 is predicted to interact with nucleic acids?

If sequence analysis suggests AF_0085 may bind DNA (similar to HSR1), employ a systematic approach:

  • Initial Screening with EMSA: Test binding to promoter regions of genes with related functions or co-expressed genes, using protein concentrations ranging from 125-2000 nM to distinguish specific from non-specific binding .

  • Determination of Binding Affinity: Calculate apparent Kd values through quantitative binding assays.

  • Footprinting Analysis: Perform DNase I footprinting to precisely map binding sites, as was done to identify the HSR1 protected region downstream of the TATA box .

  • Binding Motif Identification: Analyze protected regions for palindromic motifs or other sequence patterns that may represent recognition elements.

  • Mutational Analysis: Create targeted mutations in putative binding sites to confirm specificity and importance of key nucleotides.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.