Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0095 (AF_0095)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Functional Hypotheses

AF_0095 belongs to a subset of uncharacterized proteins in A. fulgidus’ genome, which comprises approximately 25% of its 2.18-Mb genome . While no direct functional studies on AF_0095 exist, genomic comparisons suggest potential roles in:

  • Metabolic Pathways: A. fulgidus is a sulfate-reducing archaeon with extensive biosynthetic pathways for nucleotides, amino acids, and cofactors .

  • Thermostability: As a hyperthermophile, A. fulgidus proteins often exhibit structural resilience, a trait exploited in biotechnological applications .

Research Applications and Supplier Information

AF_0095 is marketed as a tool for structural or functional studies. Key suppliers include:

SupplierProduct Catalog NumberAdvantages
CUSABIO TECHNOLOGY LLCCB215628662 High-purity recombinant protein
Creative BioMartRFL32757AF Full-length expression, His-tagged

Limitations and Research Gaps

  • Functional Data: No peer-reviewed studies directly investigate AF_0095’s enzymatic activity, binding partners, or metabolic role.

  • Biochemical Properties: Kinetic parameters (e.g., K<sub>m</sub>, V<sub>max</sub>) and cofactor dependencies remain undefined.

  • Pathway Involvement: While linked to hypothetical pathways, specific interactions or regulatory mechanisms are unverified .

Comparative Insights from Related Proteins

While AF_0095 lacks direct characterization, insights can be drawn from analogous A. fulgidus proteins:

  • Inositol-1-Phosphate Synthase (IPS): A class II aldolase requiring Zn²⁺/Mn²⁺ for activity, highlighting metal-dependent enzymatic mechanisms in archaeal proteins .

  • Uracil-DNA Glycosylase (Afung): Demonstrates β-elimination repair activity, suggesting diverse DNA repair strategies in A. fulgidus .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
AF_0095; Uncharacterized protein AF_0095
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0095
Target Protein Sequence
MERWDPLTWHCIISSYYFYIFWNFFLPMFIVYRGFGLLDPFAVKGRYTSDCYIFLLSEEP FENVTHCSSQRQSWALWSSHQRISRLQRLTTEHHKANRGQATIRKTLA
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0095

STRING: 224325.AF0095

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is currently known about the genomic context of AF_0095 in Archaeoglobus fulgidus?

AF_0095 (UniProt accession: O30141) is an uncharacterized protein from Archaeoglobus fulgidus strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126 . While limited direct information exists about AF_0095 specifically, genomic analysis methods similar to those used for other A. fulgidus proteins can be applied. For instance, when studying heat shock proteins in A. fulgidus, researchers used whole-genome microarrays to identify regulatory regions and examine expression patterns across the genome . For AF_0095, researchers should analyze neighboring genes, promoter elements, and potential operon structures to gain insights into its possible function. Comparative genomic analysis with related archaeal species can also reveal evolutionary conservation patterns that may indicate functional importance.

How should researchers approach initial protein characterization studies for AF_0095?

For initial characterization, a systematic approach should begin with:

  • Sequence analysis: Perform bioinformatic analysis of the primary structure using tools like BLAST, PFAM, and INTERPRO to identify conserved domains, motifs, and potential homologs.

  • Biochemical characterization: Determine basic properties including:

    • Molecular weight confirmation via SDS-PAGE

    • Isoelectric point

    • Thermostability profile (critical for hyperthermophilic proteins)

    • Oligomerization state via size-exclusion chromatography

  • Expression analysis: Determine natural expression conditions by RT-PCR or RNA-Seq under various growth conditions, similar to methods used for heat shock protein studies in A. fulgidus .

When working with hyperthermophilic archaeal proteins like those from A. fulgidus, which optimally grows at 83°C, all characterization assays should be conducted at physiologically relevant temperatures to obtain meaningful results.

What expression systems are most effective for recombinant production of AF_0095?

For recombinant expression of A. fulgidus proteins, both prokaryotic and eukaryotic systems have been employed with varying success. Studies on other A. fulgidus proteins demonstrate that E. coli can be an effective heterologous expression system. For example, the heat shock regulator protein HSR1 (encoded by AF1298) was successfully expressed and purified from E. coli .

For AF_0095 expression, consider these methodological approaches:

  • Prokaryotic expression:

    • E. coli BL21(DE3) with pET-based vectors is the recommended starting point

    • Codon optimization may be necessary due to different codon usage between archaea and bacteria

    • Consider fusion tags that enhance solubility (MBP, SUMO) as archaeal proteins can exhibit folding challenges in mesophilic hosts

  • Temperature considerations:

    • Initial expression at lower temperatures (18-25°C) may improve folding despite the thermophilic origin

    • Post-expression heat treatment (60-70°C) can be used as a purification step, as host proteins will denature while the thermostable AF_0095 should remain soluble

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using histidine tags

    • Ion exchange chromatography based on theoretical pI

    • Size exclusion chromatography as a final polishing step

What are the optimal buffer conditions for maintaining AF_0095 stability during purification and storage?

When working with hyperthermophilic proteins like AF_0095, buffer composition is critical for maintaining structural integrity. Based on protocols for other A. fulgidus proteins:

Recommended buffer composition table:

Buffer ComponentRecommended RangeNotes
pH7.0-8.0A. fulgidus cytoplasmic pH is near neutral
Salt (NaCl)300-500 mMHigher salt concentrations enhance stability of thermophilic proteins
Reducing agent1-5 mM DTT or 0.5-2 mM TCEPPrevents oxidation of cysteine residues
Stabilizers5-10% glycerolPrevents aggregation during freeze-thaw cycles
Storage temperature-80°C (long-term)Flash-freeze in liquid nitrogen to prevent formation of damaging ice crystals

For experimental work, researchers should verify protein stability at the intended working temperature (which may be elevated for enzymes from hyperthermophiles) through thermal shift assays or activity measurements over time.

What techniques should be prioritized for resolving the structure of AF_0095?

For structural characterization of an uncharacterized protein like AF_0095, a hierarchical approach using complementary techniques is recommended:

  • Secondary structure prediction:

    • Begin with in silico prediction tools (PSIPRED, JPred)

    • Validate predictions with circular dichroism (CD) spectroscopy to determine α-helix and β-sheet content

    • Perform differential scanning calorimetry to assess thermal stability and domain organization

  • Tertiary structure determination:

    • X-ray crystallography remains the gold standard for high-resolution structures

    • For crystallization, use sparse matrix screens designed for thermophilic proteins (higher salt concentrations, reduced precipitants)

    • Screen conditions at multiple temperatures (4°C, 20°C, and potentially higher)

  • Alternative approaches if crystallization proves difficult:

    • Cryo-electron microscopy (especially if AF_0095 forms larger complexes)

    • NMR spectroscopy (if molecular weight is under 30 kDa)

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

  • Computational modeling:

    • Leverage recent advances in AlphaFold2 and RoseTTAFold for accurate structure prediction

    • Validate computational models against experimental data from limited proteolysis or crosslinking mass spectrometry

How can researchers identify potential DNA-binding capabilities of AF_0095?

If sequence analysis suggests potential DNA-binding properties (e.g., presence of helix-turn-helix motifs as seen in the HSR1 protein of A. fulgidus ), systematic DNA-binding studies should be conducted:

  • Electrophoretic mobility shift assays (EMSA):

    • Begin with genomic fragments near the AF_0095 locus to test for autoregulation

    • Expand to promoter regions of genes with similar expression patterns

    • For HSR1 (AF1298), EMSAs revealed specific binding to promoters of certain heat shock genes with an apparent Kd of approximately 200 nM

  • DNase I footprinting:

    • For defining precise binding regions, as demonstrated for HSR1 which revealed a specific binding motif (CTAAC-N5-GTTAG)

    • Use both coding and non-coding strands to confirm protection patterns

  • Systematic Evolution of Ligands by Exponential Enrichment (SELEX):

    • To identify consensus binding sequences when no prior information is available

    • Validate SELEX-derived motifs with EMSAs and footprinting

  • Chromatin immunoprecipitation (ChIP):

    • For in vivo confirmation of binding sites identified in vitro

    • Requires specific antibodies against AF_0095 or epitope-tagged versions

What approaches can help determine if AF_0095 plays a role in heat shock response similar to other A. fulgidus proteins?

To investigate potential heat shock response roles for AF_0095, researchers should follow a systematic approach similar to that used for other A. fulgidus heat shock proteins:

  • Expression analysis under stress conditions:

    • Perform RT-qPCR or RNA-Seq on A. fulgidus cultures exposed to various stress conditions (temperature shifts, pH changes, oxidative stress)

    • Compare expression patterns with known heat shock genes like AF1298, AF1297, and AF1296, which have been shown to form an operon with maximum expression at 5 minutes post-heat shock

  • Knockout/knockdown studies:

    • Generate deletion mutants if genetic tools are available for A. fulgidus

    • Assess phenotypic changes under stress conditions

  • Protein-protein interaction studies:

    • Conduct pull-down assays to identify binding partners

    • Use bacterial/yeast two-hybrid systems or co-immunoprecipitation

    • Look specifically for interactions with known heat shock proteins like Hsp20 (AF1296) or Cdc48 (AF1297)

  • Comparative analysis:

    • Analyze microarray data similar to that collected for A. fulgidus heat shock response, which identified approximately 350 differentially expressed genes out of 2,410 ORFs

    • Position AF_0095 within the broader heat shock response network

How can researchers determine if AF_0095 has enzymatic activity?

For enzymological characterization of uncharacterized proteins like AF_0095:

  • Activity screening:

    • Perform substrate screening assays based on predicted functional domains

    • Test common enzymatic activities (hydrolase, transferase, oxidoreductase)

    • Use high-throughput colorimetric or fluorescence-based assays

  • Kinetic characterization:

    • For any identified activity, determine basic kinetic parameters:

ParameterMethodExpected Range for Thermophilic Enzymes
KmVarying substrate concentrationOften higher than mesophilic counterparts
kcatTime-course assaysMay be lower at standard temperatures
Temperature optimumActivity assays at different temperaturesLikely 70-90°C for A. fulgidus proteins
pH optimumActivity assays at different pH valuesTypically 6.0-8.0
ThermostabilityHalf-life measurements at elevated temperaturesHours to days at 80°C
  • Substrate specificity:

    • Test structurally related compounds to determine specificity profiles

    • Consider native metabolic context based on genomic neighborhood

  • Inhibition studies:

    • Test with general class-specific inhibitors to confirm enzyme classification

    • Perform product inhibition studies to understand regulatory mechanisms

How can researchers investigate the potential role of AF_0095 in transcriptional regulation networks?

If sequence analysis suggests potential involvement in transcriptional regulation (similar to HSR1/AF1298 ), consider these advanced approaches:

  • Regulatory network mapping:

    • Perform RNA-Seq after AF_0095 overexpression or depletion

    • Compare affected genes with those differentially expressed during heat shock

    • Look for enrichment of specific motifs in promoters of affected genes

  • DNA binding site identification:

    • Conduct ChIP-seq to map genome-wide binding sites

    • Analyze binding sites for common sequence motifs

    • Compare with known regulons for other A. fulgidus transcription factors

  • Regulatory mechanism investigation:

    • Determine if AF_0095 functions as an activator or repressor through reporter gene assays

    • Investigate potential interaction with basal transcription machinery components

    • For context, HSR1 (AF1298) was shown to bind near the TATA box, overlapping transcriptional start sites, suggesting a regulatory role

  • Environmental response integration:

    • Assess how temperature, redox state, and nutrient availability affect AF_0095 function

    • Test for post-translational modifications that might regulate activity

What methodological approaches should be used to investigate potential protein-protein interactions of AF_0095?

To thoroughly characterize the interactome of AF_0095:

  • In vitro interaction studies:

    • Surface plasmon resonance (SPR) for direct binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for interactions under near-native conditions

  • Crosslinking mass spectrometry (XL-MS):

    • Use thermostable crosslinkers suitable for hyperthermophilic proteins

    • Identify proximal lysine residues to map interaction surfaces

    • Generate distance restraints for structural modeling

  • Co-expression analysis:

    • Analyze transcriptomic data to identify genes with expression patterns highly correlated with AF_0095

    • Look for potential operonic structures that might indicate functional relationships

  • Protein complex isolation:

    • Tandem affinity purification (TAP) tagging of AF_0095

    • Blue native PAGE for native complex isolation

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) for complex stoichiometry determination

How should researchers integrate multi-omics data to develop hypotheses about AF_0095 function?

For comprehensive functional hypothesis development:

  • Integrative bioinformatics workflow:

    a. Sequence-based analysis:

    • Homology detection using HHpred and HMMER

    • Co-evolution analysis with direct coupling analysis (DCA)

    • Phylogenetic profiling to identify functionally related proteins

    b. Structural information integration:

    • Map conservation scores onto structural models

    • Identify potential ligand binding pockets

    • Compare with structural neighbors in PDB

    c. Expression data correlation:

    • Integrate with existing microarray data from A. fulgidus studies

    • Identify co-expressed gene clusters

    • Apply gene set enrichment analysis for functional insights

    d. Metabolic context analysis:

    • Position within reconstructed metabolic networks of A. fulgidus

    • Predict potential substrates based on pathway gaps

  • Visualizing integrated data:

    • Use Cytoscape for network visualization

    • Employ dimensional reduction techniques (PCA, t-SNE) for pattern recognition

    • Develop interactive dashboards for hypothesis generation

What computational methods should be employed to predict potential functional partners for AF_0095?

To predict functional associations:

  • Network-based approaches:

    • Protein-protein interaction prediction using interolog mapping

    • Co-expression networks from transcriptomic data

    • Gene neighborhood analysis across multiple archaeal genomes

  • Machine learning methods:

    • Train classifiers on known functional relationships in archaea

    • Use embedding techniques to capture functional similarity

    • Employ graph neural networks for relationship prediction

  • Evolutionary approaches:

    • Phylogenetic profiling to identify co-evolving genes

    • Mirror tree analysis for co-evolutionary relationships

    • Synteny conservation analysis across related archaeal species

  • Integration with experimental validation planning:

    • Prioritize predicted interactions for experimental testing

    • Design targeted validation experiments based on confidence scores

    • Develop feedback loops between computational prediction and experimental validation

How can researchers design experiments to assess the physiological impact of AF_0095 in A. fulgidus?

For phenotypic characterization:

  • Genetic manipulation approaches:

    • Design gene knockout/knockdown strategies, recognizing the challenges in archaeal genetic systems

    • Consider CRISPR-Cas9 approaches adapted for thermophilic archaea

    • Design complementation experiments to confirm phenotype specificity

  • Physiological stress response analysis:

    • Test growth under various stress conditions (temperature shifts, pH, salt, oxidative stress)

    • Monitor survival rates and recovery capabilities

    • Compare with known stress response mutants (e.g., in heat shock genes like AF1298 )

  • Metabolomic profiling:

    • Analyze metabolite changes in wild-type vs. AF_0095 mutants

    • Focus on metabolites relevant to A. fulgidus energy metabolism (sulfate reduction, hydrogen utilization)

    • Identify potential metabolic bottlenecks or pathway alterations

  • Microscopy and ultrastructural analysis:

    • Examine cellular morphology changes under stress conditions

    • Use fluorescent protein fusions to track AF_0095 localization

    • Employ transmission electron microscopy for ultrastructural phenotypes

By following these methodological approaches, researchers can systematically characterize the previously uncharacterized protein AF_0095 from Archaeoglobus fulgidus and develop robust hypotheses about its function within this hyperthermophilic archaeon's biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.