Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0123 (AF_0123)

What are the basic molecular characteristics of AF_0123?

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0123 is a full-length protein with 135 amino acids. Its amino acid sequence is: MNVEVGEECIRFAKVIRYFTLAGLILLVVSSAMYLLDIDPFVEPDRVVETWHLPASEFWKVNVGKEMESYSEFLYIAHPDNVAVFSLFFLALAPVFALLSILPKMKGIYRILTILVVAELLFGAVRPLILGAIGE. The protein is cataloged under UniProt accession number O30114, and its expression region spans positions 1-135 of the sequence . Structurally, based on sequence analysis, AF_0123 appears to contain multiple hydrophobic regions, suggesting it may be a membrane-associated protein, which aligns with the known membrane-related energy conservation mechanisms in A. fulgidus .

Which expression systems are optimal for producing recombinant AF_0123?

The selection of expression systems for AF_0123 should be guided by experimental requirements. While specific data for AF_0123 is limited, research on similar uncharacterized proteins from A. fulgidus demonstrates successful expression in multiple hosts:

What buffer conditions best preserve AF_0123 stability during purification and storage?

Based on information from similar Archaeoglobus fulgidus proteins, AF_0123 is typically stored in a Tris-based buffer with 50% glycerol optimized specifically for this protein . For hyperthermophilic archaeal proteins like AF_0123, stability concerns are particularly important during purification and storage. The recommended storage temperature is -20°C, with extended storage preferably at -20°C or -80°C. It's advisable to avoid repeated freeze-thaw cycles, as this can significantly reduce protein activity. For working aliquots, storage at 4°C is appropriate for up to one week . Researchers should consider adding reducing agents like DTT or β-mercaptoethanol to prevent oxidation of cysteine residues, particularly important given the presence of cysteine in the AF_0123 sequence.

What is the phylogenetic context of Archaeoglobus fulgidus and how does it influence AF_0123 research?

Archaeoglobus fulgidus belongs to the archaeal lineage and is phylogenetically associated with the Methanosarcinales, Methanomicrobiales, and uncultured ANME-1 groups . This positioning is significant for AF_0123 research because:

• Comparative analysis between AF_0123 and homologous proteins in these related lineages may reveal evolutionary conservation patterns.

• A. fulgidus acquired its dissimilatory sulfate reduction pathway through lateral gene transfer from an early ancestor of clostridial sulfate-reducing prokaryotes (SRP) . This transfer event may influence the function and interaction partners of proteins like AF_0123.

• The unique position of Archaeoglobus as an archaeal sulfate reducer makes its proteins particularly valuable for understanding the convergent evolution of metabolic pathways across domains of life.
  Researchers should consider this evolutionary context when designing comparative studies or when selecting homologs for functional prediction .

How does AF_0123 compare to other uncharacterized proteins in Archaeoglobus fulgidus?

Although AF_0123's specific function remains uncharacterized, comparing it with other proteins from A. fulgidus reveals potentially significant patterns:

What experimental approaches are recommended for initial functional characterization of AF_0123?

For initial functional characterization of AF_0123, researchers should employ a systematic approach integrating computational and experimental methods:

• Computational Analysis:

  • Conduct sequence-based prediction using tools like InterPro, Pfam, and SMART

  • Apply structural prediction via AlphaFold2 or RoseTTAFold

  • Perform comparative genomics to identify conserved genomic context across Archaeoglobus species

• Expression and Purification Optimization:

  • Test multiple expression systems (E. coli, yeast) with different tags (His, GST, MBP)

  • Optimize purification protocols with consideration for the hyperthermophilic nature of the protein

  • Verify protein folding through circular dichroism or limited proteolysis

• Initial Functional Assays:

  • Assess membrane association using fractionation studies

  • Determine if AF_0123 interacts with components of the sulfate reduction pathway

  • Test for interactions with electron transport chain components, particularly given A. fulgidus' energy metabolism

• Gene Context Analysis:

  • Examine co-located genes, as A. fulgidus contains functional gene clusters like those encoding lactate dehydrogenases (lldD, dld, lldEFG)

  • Analyze transcriptional responses under different growth conditions
    This multifaceted approach provides complementary data streams that can converge on potential functions, especially important for uncharacterized proteins like AF_0123.

How should researchers design experiments to determine if AF_0123 is involved in energy metabolism?

Given A. fulgidus' complex energy metabolism pathways , investigating AF_0123's potential role requires carefully designed experiments:

• Transcriptional Analysis:

  • Compare AF_0123 expression levels during growth on different energy sources (H2/CO2 vs. lactate)

  • Analyze co-expression patterns with known energy metabolism genes like those encoding Fqo complex or hydrogenases

• Protein Localization:

  • Determine subcellular localization using immunogold electron microscopy

  • Assess membrane association through biochemical fractionation

  • If membrane-associated, determine orientation using protease protection assays

• Protein-Protein Interactions:

  • Conduct pull-down assays with known components of A. fulgidus energy conservation pathways

  • Use bacterial two-hybrid systems adapted for archaeal proteins

  • Apply proximity labeling approaches (BioID or APEX) to identify interaction partners in vivo

• Functional Assays:

  • Measure electron transfer capabilities using artificial electron acceptors/donors

  • Test involvement in menaquinone metabolism, given its importance in A. fulgidus

  • Assess if AF_0123 affects the activity of F420H2:quinone oxidoreductase or other key energy-converting enzymes

• Genetic Approaches:

  • Attempt gene deletion or silencing (if genetic tools are available)

  • Heterologous expression in model organisms with defined energy metabolism
    These approaches would help determine if AF_0123 participates in A. fulgidus' energy conservation mechanisms, potentially linking it to the dissimilatory sulfate reduction pathway or hydrogen metabolism .

What approaches can researchers use to study potential membrane association of AF_0123?

The hydrophobic regions in AF_0123's sequence suggest possible membrane association. To investigate this feature:

• Computational Prediction:

  • Apply membrane protein topology prediction algorithms (TMHMM, Phobius)

  • Use hydrophobicity analysis to identify potential transmembrane regions

  • Predict lipid modification sites that might anchor the protein to membranes

• Biochemical Verification:

  • Perform membrane fractionation studies followed by Western blotting

  • Use phase separation with Triton X-114 to determine hydrophobic properties

  • Apply alkaline carbonate extraction to distinguish peripheral from integral membrane proteins

• Structural Techniques:

  • Employ electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

  • Use neutron reflectometry to determine membrane insertion depth

  • Apply solid-state NMR for structural analysis in membrane mimetics

• Functional Approaches:

  • Reconstitute purified AF_0123 in liposomes to assess functionality

  • Examine ion or small molecule transport capabilities across membranes

  • Test for interactions with known membrane-associated complexes from A. fulgidus, such as the F420H2:quinone oxidoreductase complex (Fqo)
    This comprehensive approach can determine not only if AF_0123 associates with membranes but also how this association relates to its function in the context of A. fulgidus' energy metabolism.

How can researchers utilize AF_0123 in structural biology studies?

For structural characterization of AF_0123, researchers should consider both the challenges and opportunities presented by proteins from hyperthermophilic archaea:

• X-ray Crystallography:

  • Exploit the inherent stability of thermophilic proteins for crystallization

  • Screen multiple constructs with varied N/C-terminal boundaries

  • Consider co-crystallization with potential binding partners from A. fulgidus energy metabolism pathways

• Cryo-electron Microscopy:

  • Particularly valuable if AF_0123 forms part of a larger complex

  • May require fusion to larger proteins or scaffolds to overcome size limitations

  • Consider detergent selection carefully if AF_0123 is membrane-associated

• NMR Spectroscopy:

  • Isotopic labeling through expression in minimal media

  • Solution NMR for structure determination if size permits

  • Solid-state NMR if associated with membranes or forming larger assemblies

• Computational Structure Prediction and Validation:

  • Apply AlphaFold2 or similar tools, particularly effective for archaeal proteins

  • Validate predictions with limited experimental data (crosslinking, SAXS)

  • Use molecular dynamics simulations to explore dynamics, especially at high temperatures

• Thermal Stability Considerations:

  • Exploit the hyperthermophilic nature of AF_0123 for structural studies at elevated temperatures

  • Compare structures at mesophilic versus thermophilic conditions

  • Investigate structural elements contributing to thermostability
    These approaches capitalize on the unique properties of proteins from hyperthermophilic archaea like A. fulgidus, potentially yielding insights into both AF_0123's function and general principles of protein thermostability.

How does AF_0123 compare to similar proteins in the context of extremophile biology?

Comparing AF_0123 to proteins from other extremophiles provides valuable context:

• Thermophilic Adaptation:

  • A. fulgidus proteins like AF_0123 typically display adaptations to high temperatures (optimal growth at 83°C)

  • Look for increased hydrophobic core packing, additional salt bridges, and reduced surface loops

  • Compare thermostability mechanisms with those from other hyperthermophiles (e.g., Pyrococcus, Thermococcus)

• Domain Conservation:

  • Analyze domain architecture across archaeal lineages

  • Identify thermophile-specific sequence motifs that might be present in AF_0123

  • Compare with homologs from mesophilic archaea to highlight thermoadaptive features

• Functional Equivalents:

  • Investigate if AF_0123-like proteins exist in other extremophiles with different adaptations

  • Compare with proteins from acidophiles or halophiles to distinguish thermophilic from general extremophilic adaptations

  • Examine potential horizontal gene transfer patterns among extremophiles

• Evolutionary Rate Analysis:

  • Determine if AF_0123 evolves at rates similar to other A. fulgidus proteins

  • Compare evolutionary rates between thermophilic and mesophilic homologs

  • Identify positions under positive or purifying selection
    This comparative approach places AF_0123 in the broader context of extremophile biology, potentially revealing adaptive features that contribute to its function in high-temperature environments.

What can researchers learn from comparing AF_0123 to proteins involved in A. fulgidus energy metabolism?

A. fulgidus possesses complex energy metabolism pathways , and comparing AF_0123 to characterized components may reveal functional insights:

• Pathway Association Analysis:

  • Compare sequence features with proteins involved in dissimilatory sulfate reduction

  • Look for similarities to components of the F420H2:quinone oxidoreductase complex (Fqo)

  • Analyze potential relationships to hydrogenases or other electron transfer proteins

• Expression Pattern Comparison:

  • Compare transcriptional patterns with known energy metabolism genes

  • Analyze if AF_0123 is co-regulated with genes for autotrophic or heterotrophic growth

  • Determine if expression changes when switching between electron donors (H2 vs. lactate)

• Structural Comparison:

  • Look for structural motifs common to electron transfer proteins

  • Compare predicted structure with menaquinone-interacting proteins

  • Identify potential cofactor binding sites similar to those in characterized components

• Genomic Context Analysis:

  • Determine if AF_0123 is located near genes encoding energy metabolism components

  • Compare with genomic organization patterns seen in lactate dehydrogenase clusters (lldD, dld, lldEFG)

  • Analyze if genomic context is conserved across Archaeoglobus species
    This comparative approach may position AF_0123 within A. fulgidus' energy metabolism network, suggesting specific functions in electron transfer, substrate oxidation, or regulatory roles.

What novel techniques might advance our understanding of AF_0123 function?

Emerging technologies offer new avenues for investigating uncharacterized proteins like AF_0123:

• CRISPR Technologies in Archaeal Systems:

  • Adapt CRISPR-based systems for functional genomics in A. fulgidus

  • Consider dual-function base editors for targeted mutagenesis

  • Develop CRISPR interference (CRISPRi) approaches for conditional knockdowns

• Single-Cell Approaches:

  • Apply single-cell transcriptomics to heterogeneous A. fulgidus populations

  • Develop microfluidic systems compatible with hyperthermophilic growth conditions

  • Use FISH-based methods to visualize AF_0123 expression in relation to metabolic state

• Advanced Structural Methods:

  • Apply integrative structural biology combining multiple data types

  • Use time-resolved structural methods to capture conformational changes

  • Implement native mass spectrometry for complex composition analysis

• Synthetic Biology Frameworks:

  • Reconstitute minimal systems with AF_0123 and interacting partners

  • Develop conditional expression systems for A. fulgidus

  • Engineer chimeric proteins to test domain functionality

• In Situ Techniques:

  • Develop methods for visualizing protein localization in intact A. fulgidus cells

  • Apply correlative light and electron microscopy (CLEM) to connect function with ultrastructure

  • Implement proximity labeling methods optimized for archaeal systems
    These approaches could overcome the current limitations in studying uncharacterized archaeal proteins and provide mechanistic insights into AF_0123's function.

What are the most significant methodological challenges in studying AF_0123, and how can researchers address them?

Studying uncharacterized proteins from hyperthermophilic archaea presents unique challenges:

• Expression and Purification Challenges:

  • Challenge: Maintaining proper folding of thermophilic proteins in mesophilic expression hosts

  • Solution: Test thermophilic expression hosts or develop in vitro refolding protocols specific for thermostable proteins

• Functional Assay Development:

  • Challenge: Standard assays may not work at A. fulgidus' optimal temperature (83°C)

  • Solution: Develop high-temperature compatible assay formats; consider computational predictions to narrow potential functions

• Genetic Manipulation Limitations:

  • Challenge: Limited genetic tools for A. fulgidus

  • Solution: Adapt technologies from related archaea; consider heterologous expression in genetically tractable hosts

• Structural Biology Hurdles:

  • Challenge: Membrane proteins are difficult to crystallize or study by conventional methods

  • Solution: Use detergent screening, lipidic cubic phase crystallization, or cryo-EM for membrane-associated proteins

• Physiological Relevance:

  • Challenge: Connecting molecular data to A. fulgidus' complex physiology

  • Solution: Develop systems biology approaches integrating transcriptomics, proteomics, and metabolomics under varying growth conditions By addressing these methodological challenges, researchers can make significant advances in understanding not only AF_0123 but also broader principles of protein function in extremophiles.