Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0145 (AF_0145)

What is AF_0145 and what are its basic structural characteristics?

AF_0145 is an uncharacterized protein from the hyperthermophilic archaeon Archaeoglobus fulgidus with a full length of 112 amino acids. The protein has the UniProt ID O30092 and its complete amino acid sequence is: "MCRCRCMAMMSFVAIVTPLTMLTGLIDWKYRYDMRKVPIIQRKVITGIVGYVFVVVYVVLHSLTDYSLAALAMALVFFAITGEYGGKLVHGARTLLCLKNLRKGSSQKSNPN" . As an uncharacterized protein, its specific cellular function remains to be fully elucidated, representing an exciting opportunity for novel research into archaeal biology. Preliminary structural analysis suggests membrane-associated characteristics based on its amino acid composition, with hydrophobic regions potentially indicating transmembrane domains.

What expression systems are suitable for AF_0145 production?

E. coli has been successfully utilized as a heterologous expression system for recombinant AF_0145 protein production . When expressing this archaeal protein in bacterial systems, researchers typically use an N-terminal His-tag to facilitate purification. The expression in E. coli yields the protein in sufficient quantities for subsequent biochemical and structural characterization studies. The methodology follows standard recombinant protein expression protocols, with adaptations to accommodate potential challenges in expressing archaeal proteins in mesophilic hosts. For optimal results, strain selection, temperature optimization, and induction conditions should be carefully determined through pilot experiments.

How is recombinant AF_0145 typically purified and stored?

After expression in E. coli, His-tagged AF_0145 can be purified using standard affinity chromatography techniques. The purified protein is typically supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE . For storage, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with addition of 5-50% glycerol as a cryoprotectant for long-term storage at -20°C or -80°C . To maintain protein integrity, repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week. The storage buffer typically consists of Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What is known about the archaeon Archaeoglobus fulgidus?

Archaeoglobus fulgidus is a hyperthermophilic archaeon that has been the subject of significant research due to its extreme environment adaptations . The organism has several unique proteins, including ferritin (AfFtn) which assembles with unprecedented tetrahedral symmetry, forming a structure with four large triangular pores approximately 45 Å in diameter . Studies on the heat shock response of A. fulgidus have shown that approximately 14% of its genes exhibit changed transcript abundance under thermal stress . The organism represents an important model for understanding archaeal biology and adaptations to extreme environments. Research on its uncharacterized proteins like AF_0145 may provide insights into novel biological mechanisms and potential biotechnological applications.

What experimental approaches are recommended for functional characterization of AF_0145?

Functional characterization of uncharacterized proteins like AF_0145 requires a multi-faceted approach:

• Bioinformatic Analysis: Initial characterization should include comparative sequence analysis using tools like BLAST, HMMER, and protein structure prediction algorithms to identify potential domains and conserved motifs. Genomic context analysis examining neighboring genes may provide clues to function .

• Gene Knockout/Knockdown Studies: CRISPR-Cas9 or traditional gene disruption methods adapted for archaea can illuminate phenotypic changes resulting from AF_0145 deletion.

• Protein-Protein Interaction Studies: Pull-down assays, co-immunoprecipitation, or yeast two-hybrid screening modified for extremophile proteins can identify interaction partners .

• Subcellular Localization: Fusion with fluorescent tags followed by microscopy can determine localization patterns, though adaptations for hyperthermophilic conditions are necessary.

• Biochemical Assays: Based on sequence analysis predictions, targeted enzymatic activity tests should explore potential functions.

• Structural Biology Approaches: X-ray crystallography or cryo-EM studies can provide structural insights to inform functional hypotheses.

Success in functional characterization will likely require adapting standard protocols to accommodate the thermophilic nature of this archaeal protein, potentially including assays conducted at elevated temperatures.

How might AF_0145 relate to the heat shock response in Archaeoglobus fulgidus?

Examining potential relationships between AF_0145 and the heat shock response in A. fulgidus requires careful experimental design and consideration of existing research on archaeal stress responses. Studies have shown that approximately 350 of the 2,410 open reading frames (about 14%) in A. fulgidus exhibit altered transcript abundance during heat shock . Although AF_0145 is not specifically mentioned among these genes in the available literature, investigating its potential role requires:

• Transcriptional Analysis: qRT-PCR or RNA-seq experiments comparing AF_0145 expression under normal and heat shock conditions.

• Promoter Analysis: Examining the upstream region of AF_0145 for potential binding sites of known heat shock regulators, similar to the HSR1 regulator (AF1298) identified in A. fulgidus that contains a helix-turn-helix DNA binding motif .

• Comparative Studies: Analysis alongside known heat shock proteins like Hsp20 and cdc48 (an AAA+ ATPase) to identify potential functional relationships .

• Protein Stability Assays: Testing the thermostability of recombinant AF_0145 at various temperatures to determine if its stability profile aligns with heat shock proteins.

The methodological approach should include appropriate controls and replication to ensure reliable data interpretation, particularly when working with an uncharacterized protein from a hyperthermophilic organism.

What structural analysis methods are most appropriate for studying AF_0145?

The structural analysis of AF_0145 requires a comprehensive approach utilizing complementary techniques:

A strategic approach would begin with computational predictions and biophysical characterization (CD, thermal shift assays) before proceeding to more resource-intensive techniques like X-ray crystallography or cryo-EM.

What comparative genomic approaches might reveal AF_0145's function?

Comparative genomic approaches offer powerful insights for understanding uncharacterized proteins like AF_0145:

• Phylogenetic Profiling: Identifying the presence/absence patterns of AF_0145 homologs across diverse archaeal and bacterial species can reveal functional associations based on co-evolution patterns.

• Synteny Analysis: Examining the conservation of gene order around AF_0145 across related species may indicate functional relationships, particularly if it's part of an operon structure.

• Protein Domain Architecture Analysis: Comparing the arrangement of predicted domains in AF_0145 with characterized proteins can suggest functional similarities.

• Correlated Mutation Analysis: Identifying co-evolving residues within AF_0145 and between AF_0145 and other proteins can predict interaction interfaces and functional sites.

• Transcriptomic Context Comparison: Analyzing expression patterns across conditions and comparing with other archaeal species may reveal functional insights through guilt-by-association principles.

Implementation requires sophisticated bioinformatic tools and databases, including:

• Archaeal genome databases

• Protein family databases (Pfam, InterPro)

• Structure prediction servers

• Ortholog identification tools (OrthoMCL, OMA)

The methodological approach should include careful sequence similarity thresholds and phylogenetic tree construction to avoid misinterpretation due to horizontal gene transfer, which is prevalent in archaea.

How should researchers design experiments to identify potential binding partners of AF_0145?

Identifying binding partners of AF_0145 requires a systematic experimental approach:

• Pull-down Assays: The His-tagged recombinant AF_0145 can serve as bait to capture interacting proteins from A. fulgidus cell lysates . Captured proteins are then identified using mass spectrometry. Critical controls include:

  • Empty vector/tag-only negative controls

  • Validation with varying stringency wash conditions

  • Competitive elution to reduce false positives

• Yeast Two-Hybrid Screening: Modified for extremophile proteins, potentially using thermotolerant yeast strains or conducting assays at lower temperatures.

• Co-immunoprecipitation: Requires antibodies against AF_0145 or epitope tags, followed by mass spectrometry identification of co-precipitated proteins.

• Chemical Cross-linking coupled with Mass Spectrometry (XL-MS): Particularly useful for capturing transient interactions, with the advantage of providing spatial constraints for interacting regions.

• Proximity-dependent Biotin Identification (BioID): Fusion of AF_0145 with a promiscuous biotin ligase to biotinylate proximal proteins, adapting protocols for archaeal systems.

Experimental design should incorporate validation strategies, including:

• Reciprocal pull-downs

• Co-localization studies

• Functional assays testing the effect of identified interactions

Researchers should consider the thermophilic nature of A. fulgidus when designing interaction studies, potentially conducting experiments at elevated temperatures or creating chimeric systems that function at standard laboratory conditions.

What considerations are important when designing site-directed mutagenesis studies for AF_0145?

Site-directed mutagenesis studies for AF_0145 require careful planning based on structural and evolutionary insights:

• Target Selection Strategy:

  • Conserved residues identified through multiple sequence alignments

  • Predicted functional sites from computational analysis

  • Regions with unique archaeal characteristics

  • Potential membrane-interacting domains based on hydrophobicity analysis

• Mutation Types:

  • Conservative substitutions to test the importance of specific chemical properties

  • Alanine scanning to identify functionally important residues

  • Cysteine mutations for accessibility studies and potential cross-linking

  • Charged residue reversals to test electrostatic interactions

• Validation Approaches:

  • Expression validation using SDS-PAGE and Western blotting

  • Structural integrity assessment via circular dichroism or thermal shift assays

  • Functional assays based on hypothesized roles

• Technical Considerations:

  • Codon optimization for the expression system

  • Verification of mutations by sequencing

  • Assessment of protein stability and proper folding

  • Temperature considerations for a thermophilic protein

How can researchers adapt standard protein characterization methods for a hyperthermophilic protein like AF_0145?

Working with proteins from hyperthermophilic organisms like A. fulgidus requires modifications to standard protocols:

• Expression Systems: Consider using:

  • Thermophilic bacterial hosts like Thermus thermophilus

  • Cell-free systems that can operate at elevated temperatures

  • Standard E. coli systems with post-expression refolding at higher temperatures

• Buffer Considerations:

  • Higher salt concentrations to maintain protein stability

  • Temperature-stable buffers (HEPES, phosphate) that maintain pH at elevated temperatures

  • Addition of stabilizing agents like glycerol or trehalose

  • Reduced DTT concentrations (DTT degrades more rapidly at high temperatures)

• Activity Assays:

  • Temperature-controlled reaction vessels

  • Thermostable reagents and substrates

  • Calibration curves established at relevant temperatures

  • Time-course studies to account for altered reaction kinetics

• Structural Studies:

  • Perform CD spectroscopy across broad temperature ranges (25-95°C)

  • Include temperature-controlled stages for microscopy

  • Consider in situ high-temperature crystallization approaches

• Storage and Handling:

  • Test stability at various temperatures rather than assuming standard cold storage is optimal

  • Evaluate the need for specific stabilizing agents in storage buffers

Sample experimental workflow for thermal stability characterization:

• Circular dichroism measurements from 25-95°C

• Differential scanning calorimetry

• Activity assays at range of temperatures

• Protease sensitivity comparisons at different temperatures

What statistical approaches are appropriate for analyzing data from AF_0145 functional studies?

Following the experimental design principles used in research on A. fulgidus ferritin (AfFtn) , researchers should carefully design controls that isolate the variable of interest while maintaining all other conditions constant.

What are common challenges in expressing AF_0145 in E. coli and how can they be addressed?

Expressing archaeal proteins in bacterial systems presents several challenges:

• Protein Misfolding and Inclusion Body Formation:

  • Solution: Optimize growth temperature (typically lowering to 16-20°C), reduce inducer concentration, or use specialized strains like C41(DE3) designed for membrane proteins.

  • Methodological approach: Test expression at varying temperatures (37°C, 30°C, 25°C, 18°C) with different IPTG concentrations (0.1-1.0 mM).

• Codon Usage Bias:

  • Solution: Use codon-optimized synthetic genes or co-express rare tRNAs using specialized strains like Rosetta.

  • Methodological approach: Compare expression levels between native and codon-optimized sequences using western blot analysis.

• Protein Toxicity to Host Cells:

  • Solution: Use tightly controlled expression systems (like pET with T7 lysozyme co-expression) or low-copy number vectors.

  • Methodological approach: Monitor growth curves and final cell density across different expression conditions.

• Post-translational Modifications:

  • Solution: Consider eukaryotic expression systems if archaeal-specific modifications are suspected to be important.

  • Methodological approach: Compare protein activity and structure between E. coli-expressed and native-purified protein if available.

• Protein Solubility:

  • Solution: Test different solubilizing agents and fusion partners (MBP, SUMO, Thioredoxin).

  • Methodological approach: Perform small-scale expression tests with different fusion tags followed by solubility analysis.

Researchers should implement a systematic optimization strategy, testing multiple variables in pilot experiments before scaling up to production quantities. The use of design of experiments (DoE) approaches can efficiently identify optimal expression conditions.

How can researchers address challenges in structural studies of AF_0145?

Structural characterization of uncharacterized proteins like AF_0145 presents unique challenges:

Successful structural characterization will likely require iteration between different approaches, with feedback from initial results informing refinement of experimental strategies.

What mass spectrometry approaches are recommended for characterizing AF_0145?

Mass spectrometry offers powerful analytical capabilities for uncharacterized proteins like AF_0145:

Given the uncharacterized nature of AF_0145, a systematic approach beginning with protein identification and moving towards more specialized analyses based on initial findings would be most productive.

How can computational methods contribute to understanding AF_0145 function?

Computational approaches provide valuable insights for uncharacterized proteins like AF_0145:

• Sequence-Based Analysis:

  • Homology Detection: Position-Specific Iterated BLAST (PSI-BLAST) and Hidden Markov Models can identify distant homologs below the detection threshold of standard BLAST.

  • Functional Domain Prediction: Tools like InterProScan integrate multiple domain databases to identify functional units.

  • Methodological approach: Use sensitive profile-based methods with low E-value thresholds, followed by manual curation of results.

• Structural Prediction and Analysis:

  • Ab initio Structure Prediction: AlphaFold2 or RoseTTAFold can generate high-confidence structural models.

  • Structural Comparison: Tools like DALI can identify structural homologs even in the absence of sequence similarity.

  • Binding Site Prediction: CASTp, SiteMap, or FTMap can identify potential functional pockets.

  • Methodological approach: Generate multiple structural models and assess consistency across methods.

• Molecular Dynamics Simulations:

  • Conformational Sampling: Explore potential structural flexibility relevant to function.

  • Thermostability Analysis: Probe structural behavior at elevated temperatures relevant to hyperthermophiles.

  • Virtual Screening: Dock metabolite libraries to identify potential ligands.

  • Methodological approach: Conduct simulations at multiple temperatures (25°C, 85°C) to compare behavior.

• Systems Biology Approaches:

  • Gene Co-expression Analysis: Identify functionally related genes using transcriptomic data.

  • Protein-Protein Interaction Network Analysis: Predict functional associations through network topology.

  • Methodological approach: Apply context-specific filtering to focus on archaeal-relevant predictions.

• Evolutionary Analysis:

  • Ancestral Sequence Reconstruction: Infer the evolutionary history and potential functional shifts.

  • Positive Selection Analysis: Identify sites under adaptive selection.

  • Methodological approach: Construct robust phylogenies using maximum likelihood methods with appropriate substitution models.

Implementation requires integration of multiple computational tools, with careful consideration of archaeal-specific peculiarities in genomic and protein features. Results should be critically evaluated and used to guide experimental validation.

What are the most promising research directions for understanding AF_0145 function?

Based on current knowledge and the methodological approaches outlined, several research directions hold particular promise for elucidating the function of AF_0145:

• Integrated Structural-Functional Analysis: Combining structural determination with targeted mutagenesis of predicted functional sites offers a powerful approach to functional assignment. The relatively small size (112 amino acids) of AF_0145 makes it amenable to comprehensive structure-function analysis .

• Comparative Genomics in Extremophiles: Analyzing the distribution and conservation of AF_0145 across hyperthermophilic archaea could reveal evolutionary patterns indicative of functional importance in extreme environments. Research on heat shock responses in A. fulgidus provides a framework for understanding stress-responsive proteins .

• Membrane Biology Investigations: The amino acid sequence of AF_0145 suggests potential membrane association, warranting exploration of its localization and possible role in membrane integrity under extreme conditions .

• Protein-Protein Interaction Mapping: Systematic identification of interaction partners using methods adapted to thermophilic proteins could place AF_0145 in a functional context within cellular pathways.

• Conditional Essentiality Testing: Determining under which specific environmental conditions AF_0145 becomes critical for A. fulgidus survival could provide functional insights.

These research directions should be pursued with appropriate controls and rigorous experimental design, as exemplified in studies of other A. fulgidus proteins like ferritin . Collaboration across specialties including structural biology, archaeal genetics, and computational biology would accelerate progress in understanding this uncharacterized protein.

How can research on AF_0145 contribute to broader understanding of archaeal biology?

Research on uncharacterized proteins like AF_0145 has significant potential to advance our understanding of archaeal biology in several ways:

• Archaeal-Specific Adaptations: Characterizing AF_0145 may reveal novel mechanisms employed by archaea to thrive in extreme environments. A. fulgidus as a hyperthermophile represents an important model organism for understanding thermal adaptation strategies .

• Evolutionary Insights: Determining the function of AF_0145 could illuminate aspects of archaeal evolution, potentially revealing ancestral functions or specialized adaptations that emerged during archaeal diversification.

• Structural Biology Contributions: The structural characterization of AF_0145 would add to our growing database of archaeal protein structures, enhancing our understanding of protein stability and function in extreme conditions. This builds upon insights from other unique archaeal structures like the tetrahedral ferritin assembly in A. fulgidus .

• Systems Biology Integration: Placing AF_0145 within its functional context would contribute to the development of more comprehensive models of archaeal cellular networks and stress responses, complementing existing knowledge about heat shock responses in A. fulgidus .

• Methodological Advancements: Techniques developed or refined for working with AF_0145 could benefit the broader field of extremophile research, particularly in areas such as protein expression, purification, and functional characterization under non-standard conditions.