Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0267 (AF_0267)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_0267; Uncharacterized protein AF_0267
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-597
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0267
Target Protein Sequence
MKYLLLALLLCLAVGTAGGFKIVKTCEKDPRGYIADLGNGKYLMHLEGSPYEMGYQHGCL KGAEVQSMTKEFVKSVLAGYDIPEDLIPGLLKLGKEVAKGNEKYVPSEFREEMRGIADGA RDAGYDVDYDDVLLLNMGFDVILSIAYPIATPIVAWQDKKGVACDGFVAMDDATSDGRVL MGRSFMFNPEVFHEVALLIEQYPDRGHRFVSVSAPGFVGVTAAMSSAGIAIGMDMVPAMD TKPFVSGMGCLLTARQVVQYADELSDAVNMVKGSKRGVPWLYIVGDGKGREKGGAVLEVS ADKFAVRYMDYRYPEWAESLDFPKQIEDKDDLVVVANHYIVPEMYSTISYAVKDSLWRYE TLTGLILDSYGSIDVEKGKELIDYLHPPNYGYYGEDENVPVAATRTLFDLSNLELWSLYG MYTDPWAHWELTTEYQPAGLDKAWKDTEGDVAGPSWKPINYGAPIIDKEKMLDSADLQKL SEADGNYVEQCVKAYAGNPNYATIHLRFNVQSSANIMLTVADQNDGLEIYAWNYNTNDWQ KVYDRIYPSGFTTLRLSLGSEFVNNRKADLVLISEAKWKFGMIYDKACVAVDAAAVT
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0267

STRING: 224325.AF0267

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant for protein research?

Archaeoglobus fulgidus is a hyperthermophilic archaeon that has attracted significant scientific interest due to its ability to thrive in extreme temperature environments. As demonstrated in heat shock response studies, A. fulgidus can grow at temperatures ranging from 78°C to 89°C, making its proteins particularly interesting for thermostability research . The organism belongs to the domain Archaea, which represents a distinct evolutionary lineage from bacteria and eukaryotes.

A. fulgidus is significant for protein research for several reasons. First, its hyperthermophilic nature means its proteins possess exceptional stability under extreme conditions, offering insights into protein folding and stability mechanisms. Second, as an archaeon, it contains unique protein structures and regulatory mechanisms that differ from those in bacteria and eukaryotes. Third, studying uncharacterized proteins like AF_0267 from this organism may reveal novel enzymatic activities or structural motifs adapted to extreme environments, potentially leading to biotechnological applications and fundamental insights into protein evolution.

Genome-wide studies of A. fulgidus, such as the heat shock response analysis conducted using whole-genome microarrays, have revealed complex regulatory networks involving approximately 14% of the organism's 2,410 open reading frames, demonstrating sophisticated molecular mechanisms for adaptation to extreme conditions .

What are the basic structural characteristics of AF_0267?

Based on available data, AF_0267 is a full-length protein consisting of 597 amino acids from Archaeoglobus fulgidus . The protein is currently classified as "uncharacterized," indicating that its precise function and detailed structure remain to be elucidated through experimental research.

While specific structural information about AF_0267 is limited, recombinant forms of the protein have been produced with histidine tags to facilitate purification and further study . Sequence analysis and structural prediction methods would be the first step in characterizing this protein, including:

  • Primary sequence analysis for conserved domains

  • Secondary structure prediction using algorithms such as PSIPRED

  • Tertiary structure modeling using homology modeling or ab initio prediction

  • Analysis for potential functional motifs like DNA-binding domains

By analogy with other A. fulgidus proteins, such as HSR1 (encoded by AF1298), AF_0267 might contain structural motifs adapted to high-temperature environments. For instance, HSR1 contains a helix-turn-helix DNA binding motif positioned from amino acids 28 to 52 . Similar structural elements might exist in AF_0267, although determining this would require detailed sequence and structural analysis.

How is recombinant AF_0267 typically expressed and purified for research purposes?

Recombinant AF_0267 from Archaeoglobus fulgidus is typically expressed in Escherichia coli expression systems, as indicated by commercial sources of the protein . The methodological approach for expression and purification generally follows these steps:

  • Cloning: The AF_0267 gene sequence is optimized for E. coli expression, synthesized, and cloned into an appropriate expression vector containing a histidine tag sequence.

  • Expression: Transformation into a suitable E. coli strain (commonly BL21(DE3) or derivatives) is followed by culture growth and protein expression induction, typically using IPTG or auto-induction systems.

  • Cell Lysis: Bacterial cells are harvested and lysed using methods such as sonication, high-pressure homogenization, or chemical lysis.

  • Purification: The His-tagged AF_0267 protein is purified using immobilized metal affinity chromatography (IMAC), typically with Ni-NTA resin .

  • Further Purification: Additional purification steps may include ion exchange chromatography, size exclusion chromatography, or other techniques to achieve high purity.

  • Quality Control: SDS-PAGE, Western blotting, and mass spectrometry are employed to verify purity, integrity, and identity of the purified protein.

For thermostable proteins from hyperthermophiles like A. fulgidus, a heat treatment step (incubation at 70-80°C) is often included after cell lysis to precipitate thermolabile E. coli proteins while leaving the thermostable target protein in solution, serving as an effective purification step.

This approach is similar to the methodology used for other A. fulgidus proteins, such as HSR1, which was successfully expressed in E. coli and purified to homogeneity for functional studies .

What initial experimental approaches are recommended for characterizing the function of AF_0267?

For an uncharacterized protein like AF_0267, a systematic multi-faceted approach is recommended:

  • Bioinformatic Analysis:

    • Sequence homology searches against databases

    • Identification of conserved domains and motifs

    • Phylogenetic analysis to identify evolutionary relationships

    • Structural prediction and modeling

  • Biochemical Characterization:

    • Thermal stability assays to determine melting temperature

    • Circular dichroism spectroscopy for secondary structure analysis

    • Size exclusion chromatography for oligomeric state determination

    • Activity assays based on predicted functions from bioinformatic analysis

  • Interactome Analysis:

    • Pull-down assays to identify protein-protein interactions

    • Screening for potential DNA/RNA binding using electrophoretic mobility shift assays (EMSA), similar to methods used for HSR1

    • Co-immunoprecipitation studies with suspected interaction partners

  • Expression Analysis:

    • qRT-PCR to determine expression patterns under different conditions

    • RNA-seq analysis to identify co-expressed genes

    • Response to environmental stressors, particularly heat shock, given A. fulgidus' hyperthermophilic nature

  • Functional Genomics:

    • Gene knockout or knockdown studies (if genetic systems are available)

    • Heterologous expression in model organisms

    • Complementation studies with suspected orthologues

This methodological framework provides a comprehensive approach to begin unraveling the function of AF_0267, moving systematically from in silico predictions to in vitro and potentially in vivo validation.

How can researchers design experiments to investigate potential heat shock response roles of AF_0267?

Investigating AF_0267's potential involvement in heat shock response requires a carefully designed experimental approach:

  • Transcriptional Analysis During Heat Shock:

    • Expose A. fulgidus cultures to temperature shifts (e.g., from 78°C to 89°C, as documented in previous studies )

    • Use RT-qPCR to measure AF_0267 mRNA levels at different time points (5, 30, and 60 minutes post-shift)

    • Compare expression patterns with known heat shock genes like AF1296 (hsp20-1), AF1971 (hsp20-2), and AF1451 (thermosome beta subunit)

  • Promoter Analysis:

    • Identify the promoter region of AF_0267

    • Search for conserved heat shock regulatory elements similar to those identified for HSR1-regulated genes

    • Perform DNase I footprinting to identify potential binding sites for heat shock regulators

    • Conduct reporter gene assays to assess promoter activity under different temperature conditions

  • Protein-Protein Interaction Analysis:

    • Perform co-immunoprecipitation studies with known heat shock proteins

    • Use yeast two-hybrid or bacterial two-hybrid systems to screen for interactions

    • Employ proximity labeling approaches (BioID or APEX) to identify proximal proteins in vivo

    • Analyze interactions with known heat shock regulators like HSR1

  • Functional Characterization Under Stress Conditions:

    • Compare biochemical properties of AF_0267 at normal growth temperature (78°C) versus heat shock temperature (89°C)

    • Assess chaperone activity using protein aggregation assays

    • Evaluate DNA/RNA binding capabilities under different temperature conditions

    • Test enzyme activity (if applicable) at different temperatures

  • Comparative Analysis:

    • Design experiments that compare AF_0267's response to heat shock with its response to other stressors (oxidative stress, pH changes)

    • Create a response profile to determine if AF_0267 is specifically involved in heat shock or general stress response

This methodological framework follows established approaches used in studying heat shock response in A. fulgidus, where whole-genome microarrays revealed changes in mRNA levels for approximately 10% of the 2,410 genes when cells were shifted from 78°C to 89°C .

What methods can be employed to investigate potential DNA binding properties of AF_0267?

If AF_0267 is predicted to have DNA binding properties, similar to other regulatory proteins in A. fulgidus like HSR1, the following methodological approaches would be appropriate:

  • In Silico Analysis:

    • Analyze the protein sequence for known DNA binding motifs (e.g., helix-turn-helix, zinc finger)

    • Compare with established DNA binding proteins from A. fulgidus, such as HSR1 which contains a helix-turn-helix motif at positions 28-52

    • Perform structural modeling to predict DNA binding interfaces

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Express and purify recombinant AF_0267 as described earlier

    • Select candidate promoter regions for testing (start with its own promoter and promoters of co-regulated genes)

    • Perform EMSA at varying protein concentrations (e.g., 125 nM, 250 nM, 1000 nM) to detect shifts in DNA mobility

    • Include non-specific DNA controls to establish binding specificity

    • This approach was successfully used with HSR1, which showed specific binding at 125-250 nM with an apparent Kd of approximately 200 nM

  • DNase I Footprinting:

    • Identify protected regions within target promoters

    • Determine specific binding sequences, potentially revealing a consensus binding motif

    • For HSR1, this approach identified a cis-binding motif consisting of CTAAC-N5-GTTAG

  • Chromatin Immunoprecipitation (ChIP):

    • Develop antibodies against AF_0267 or use epitope-tagged versions

    • Perform ChIP followed by sequencing (ChIP-seq) to identify genome-wide binding sites

    • Analyze binding patterns under different conditions (normal growth vs. stress)

  • Systematic Evolution of Ligands by Exponential Enrichment (SELEX):

    • Use purified AF_0267 protein with random oligonucleotide libraries

    • Select for sequences that bind with high affinity

    • Identify consensus binding sequences through multiple rounds of selection

  • Fluorescence Anisotropy or Surface Plasmon Resonance:

    • Determine binding kinetics and affinity constants

    • Investigate the effects of temperature and salt concentration on binding properties

    • Compare binding parameters with those of other A. fulgidus DNA binding proteins

  • Mutational Analysis:

    • Create point mutations in predicted DNA binding regions

    • Assess effects on binding affinity and specificity

    • Correlate structural features with functional properties

These methodologies would provide comprehensive insights into the DNA binding properties of AF_0267, following established approaches that have been successful for characterizing other DNA binding proteins from A. fulgidus .

What computational approaches can predict the function of uncharacterized proteins like AF_0267?

Advanced computational approaches offer powerful tools for predicting the function of uncharacterized proteins like AF_0267:

  • Homology-Based Methods:

    • Position-Specific Iterative BLAST (PSI-BLAST) to detect remote homologs

    • Hidden Markov Model (HMM) profiles for sensitive sequence comparison

    • Structural alignment with known proteins using tools like DALI or TM-align

    • Phylogenetic profiling to identify functional associations based on evolutionary co-occurrence

  • Structural Prediction and Analysis:

    • Ab initio structure prediction using tools like AlphaFold2 or RoseTTAFold

    • Structure-based function prediction using algorithms like ProFunc or COFACTOR

    • Binding site prediction using CASTp, POCASA, or similar tools

    • Molecular dynamics simulations to investigate conformational flexibility at high temperatures

  • Network-Based Approaches:

    • Protein-protein interaction prediction using methods like STRING

    • Gene neighborhood analysis to identify operonic relationships

    • Gene co-expression networks based on transcriptomic data

    • Metabolic pathway integration and gap filling

  • Machine Learning Approaches:

    • Support Vector Machines (SVMs) for function classification

    • Deep learning models trained on protein sequences and structures

    • Feature extraction from multiple data sources for integrated prediction

    • Transfer learning from model organisms to A. fulgidus proteins

  • Text Mining and Knowledge Integration:

    • Automated literature mining to identify potential functions

    • Integration of experimental data from similar archaeal proteins

    • Ontology-based functional annotation

    • Meta-server approaches combining multiple prediction methods

  • Experimental Design Guidance:

    • In silico mutagenesis to identify critical residues for experimental validation

    • Virtual screening for potential ligands or substrates

    • Simulation of protein behavior under extreme conditions

    • Prioritization of experimental approaches based on confidence scores

These computational methods would be particularly useful for AF_0267 given the limited experimental data available for this protein. This integrated computational approach could narrow down potential functions and guide targeted experimental validation, significantly accelerating the characterization process.

How can protein-protein interactions of AF_0267 be studied in complex experimental systems?

Investigating protein-protein interactions (PPIs) of AF_0267 requires specialized approaches, particularly considering the hyperthermophilic nature of A. fulgidus:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged AF_0267 in A. fulgidus (if genetic tools are available) or in a heterologous system

    • Perform pulldown under near-native conditions, maintaining appropriate temperature during extraction

    • Identify interaction partners by mass spectrometry

    • Validate interactions with reciprocal pulldowns

    • Quantitative approaches like SILAC or TMT labeling can differentiate specific from non-specific interactions

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize transient interactions

    • Identify crosslinked peptides by specialized MS/MS analysis

    • Reconstruct interaction interfaces at amino acid resolution

    • This approach is particularly valuable for thermophilic proteins that may have different interaction dynamics at high temperatures

  • Proximity-Based Methods:

    • Employ BioID or APEX2 proximity labeling in heterologous systems

    • Adapt techniques for high-temperature organisms if possible

    • Create spatial interaction maps under different conditions

    • These approaches can capture both stable and transient interactions

  • High-Throughput Screening:

    • Yeast two-hybrid screening adapted for hyperthermophilic proteins

    • Bacterial two-hybrid systems with thermostable components

    • Protein complementation assays using split reporters

    • Protein arrays with purified A. fulgidus proteins

  • Biophysical Methods for Interaction Characterization:

    • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

    • Surface plasmon resonance (SPR) for kinetic parameters

    • Microscale thermophoresis (MST) for binding under various conditions

    • Analytical ultracentrifugation to characterize complex formation

  • Structural Studies of Complexes:

    • X-ray crystallography of AF_0267 with interaction partners

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for dynamic interactions

    • Integrative structural biology combining multiple data sources

  • Functional Validation of Interactions:

    • Co-expression studies to assess functional relevance

    • Mutational analysis of interaction interfaces

    • Competition assays with predicted binding partners

    • Correlation with physiological responses

These methodological approaches would provide a comprehensive understanding of AF_0267's interaction network, offering insights into its functional role within the complex cellular machinery of A. fulgidus.

What experimental design considerations are crucial when working with proteins from hyperthermophiles like A. fulgidus?

Working with proteins from hyperthermophiles like A. fulgidus presents unique challenges that require specific experimental design considerations:

  • Temperature Considerations:

    • Maintain appropriate temperatures during extraction and purification (typically 70-90°C for A. fulgidus proteins)

    • Design assays that function at elevated temperatures

    • Use thermostable reagents and buffers with appropriate pH adjustments for high temperatures

    • Consider the effect of temperature on reaction kinetics when comparing with mesophilic proteins

  • Buffer and Solution Stability:

    • Select buffers with minimal temperature-dependent pKa shifts

    • Account for increased hydrolysis rates at high temperatures

    • Consider using additives that enhance stability (certain salts, polyols)

    • Monitor pH changes during reactions at elevated temperatures

  • Experimental Controls and References:

    • Include appropriate thermostable reference proteins in experiments

    • Design negative controls specific to high-temperature systems

    • Consider multiple temperature points for comparison (e.g., 70°C, 80°C, 90°C)

    • Include well-characterized A. fulgidus proteins as benchmarks

  • Specialized Equipment Requirements:

    • Use heating blocks, water baths, or incubators capable of precise high-temperature control

    • Employ thermostable microplates or reaction vessels for assays

    • Consider specialized instruments for high-temperature spectroscopy or chromatography

    • Ensure temperature uniformity throughout reaction vessels

  • Stability and Activity Assays:

    • Design thermal shift assays appropriate for already thermostable proteins

    • Implement activity assays with temperature control throughout

    • Consider differential scanning calorimetry for accurate thermal stability measurement

    • Monitor time-dependent activity changes at constant elevated temperatures

The experimental design should follow established protocols that have been successful for other A. fulgidus proteins. For example, when studying HSR1, researchers successfully expressed the protein in E. coli and conducted DNA binding studies under conditions that maintained the protein's native functions . Similar approaches could be adapted for AF_0267, with appropriate modifications based on its specific properties.

How can researchers resolve contradictory data when characterizing AF_0267?

Resolving contradictory data is a common challenge in protein characterization. For AF_0267, the following methodological framework would be beneficial:

  • Systematic Validation Protocols:

    • Repeat experiments using different experimental approaches

    • Vary conditions systematically to identify parameters affecting results

    • Compare results obtained from different expression systems

    • Implement statistical methods to assess significance of contradictions

  • Technical Considerations Analysis:

    • Evaluate protein preparation methods for potential artifacts

    • Assess buffer compositions and their effects on protein properties

    • Consider post-translational modifications that might vary between preparations

    • Examine the effects of tags (His-tags, etc.) on protein behavior

  • Comparative Analysis Framework:

    • Create a systematic table documenting all contradictory results:

    PropertyMeasurement 1Measurement 2Potential Cause of DiscrepancyResolution Strategy
    Binding affinityKd = 200 nMKd = 500 nMDifferent buffer conditionsTest in physiological buffer
    ActivityHigh at pH 7Low at pH 7Different cofactor presenceSystematic cofactor testing
    Structureα/β foldMostly αDifferent algorithms usedExperimental structure determination
  • Integration of Multi-omics Data:

    • Correlate transcriptomic, proteomic, and metabolomic data

    • Use network analysis to place contradictory results in broader context

    • Examine evolutionary conservation patterns for functional insights

    • Incorporate simulation and modeling to reconcile experimental differences

  • Collaborative Verification:

    • Engage multiple laboratories in standardized protocols

    • Implement blind testing to eliminate bias

    • Use different but complementary methodologies

    • Develop consensus interpretation through expert assessment

This methodological approach acknowledges that contradictions often arise from legitimate biological complexity rather than experimental error, particularly for proteins from extremophiles like A. fulgidus, which may exhibit context-dependent behaviors.

What statistical approaches are most appropriate for analyzing experimental data on AF_0267?

  • Experimental Design Statistics:

    • Power analysis to determine appropriate sample sizes

    • Factorial design for multi-parameter experiments

    • Latin square designs for complex environmental variable testing

    • Response surface methodology for optimizing conditions

  • Data Preprocessing Methods:

    • Normality testing using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Outlier detection using Grubb's test or Dixon's Q test

    • Data transformation techniques for non-normal distributions

    • Standardization methods for comparing different measurement scales

  • Comparative Analysis Techniques:

    • Paired t-tests for before/after comparisons

    • ANOVA for multiple condition comparisons

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normal data

    • Mixed-effects models for repeated measurements

  • Correlation and Regression Approaches:

    • Pearson or Spearman correlation for association analysis

    • Multiple regression for identifying key variables

    • Principal component analysis for dimensionality reduction

    • Partial least squares for handling multicollinearity

  • Advanced Statistical Methods:

    • Bayesian analysis for incorporating prior knowledge

    • Machine learning techniques for pattern recognition

    • Survival analysis for time-to-event data

    • Meta-analysis for combining multiple studies

  • Visualization and Reporting:

    • Use standardized plots showing means with error bars representing standard error or 95% confidence intervals

    • Create comprehensive data tables including all statistical parameters:

    Experimental ConditionMean ValueStandard Deviationp-valueEffect Sizen
    Control (78°C)0.450.08--6
    Heat Shock (89°C)0.720.120.00342.566
    Recovery (78°C after shock)0.530.090.08210.956

How can AF_0267 research contribute to understanding extremophile adaptation mechanisms?

Research on AF_0267 can significantly advance our understanding of molecular adaptations to extreme environments:

  • Comparative Genomics Framework:

    • Compare AF_0267 with homologs from mesophiles, thermophiles, and other extremophiles

    • Identify amino acid substitutions associated with thermostability

    • Analyze evolutionary rates and selection pressures

    • Construct phylogenetic trees to trace adaptation trajectories

  • Structural Biology Insights:

    • Determine how AF_0267's structure contributes to thermostability

    • Identify structural elements conserved across thermophilic proteins

    • Compare folding energetics at different temperatures

    • Analyze the role of specific interactions (ion pairs, hydrophobic interactions)

  • Systems Biology Integration:

    • Place AF_0267 in the context of A. fulgidus stress response networks

    • Analyze co-evolution patterns with interacting partners

    • Develop models of thermal adaptation at the protein and system levels

    • Compare with heat shock response systems in other organisms

  • Experimental Evolution Approaches:

    • Design directed evolution experiments to modify AF_0267 temperature optima

    • Identify key residues through mutation studies

    • Test functional complementation in mesophilic systems

    • Assess fitness effects of mutations under different conditions

  • Biotechnological Applications:

    • Develop AF_0267-based thermostable tools for research or industry

    • Engineer chimeric proteins incorporating thermostable elements from AF_0267

    • Apply insights to rational design of thermostable enzymes

    • Explore potential applications in high-temperature bioprocesses

This research framework connects fundamental questions about extremophile adaptation with practical applications, potentially revealing general principles of protein adaptation to extreme environments that extend beyond A. fulgidus.

What are the most promising methods for elucidating the physiological role of AF_0267 in A. fulgidus?

To determine the physiological role of AF_0267 in A. fulgidus, an integrated methodological approach is necessary:

  • Gene Expression Contextualization:

    • Perform transcriptomic analysis across growth phases and stress conditions

    • Compare expression patterns with genes of known function

    • Use clustering analysis to identify co-expressed genes

    • This approach was successful in identifying heat shock response genes in A. fulgidus

  • Gene Manipulation Strategies:

    • Develop genetic tools for A. fulgidus if not already available

    • Create knockout or knockdown strains for AF_0267

    • Employ CRISPR-Cas9 or traditional homologous recombination techniques

    • Analyze resulting phenotypes under various conditions

  • Metabolic Impact Assessment:

    • Perform metabolomic analysis of wild-type versus AF_0267 mutant strains

    • Identify metabolic pathways affected by AF_0267 alteration

    • Use flux analysis to quantify changes in metabolic flow

    • Correlate findings with growth and survival phenotypes

  • Localization Studies:

    • Develop tagged versions of AF_0267 for localization studies

    • Use immunofluorescence or other imaging techniques adapted for A. fulgidus

    • Correlate localization with potential function

    • Examine changes in localization under different conditions

  • Regulatory Network Analysis:

    • Identify potential regulatory interactions involving AF_0267

    • Determine if AF_0267 is part of an operon structure

    • Analyze promoter elements for regulatory insights

    • This approach revealed that HSR1 (AF1298) is part of an operon with two downstream genes encoding a small heat shock protein (Hsp20) and cdc48, an AAA+ ATPase

  • Integrative Data Analysis Framework:

    • Combine all data types into a unified functional hypothesis

    • Use machine learning to identify patterns across datasets

    • Develop predictive models of AF_0267's role

    • Design targeted validation experiments based on integrated analysis

What are the most critical knowledge gaps in our understanding of AF_0267?

Despite advances in archaeal protein research, several critical knowledge gaps remain regarding AF_0267:

  • Functional Characterization:

    • The primary biochemical function remains unknown

    • Potential enzymatic activities have not been systematically tested

    • Structural features awaiting experimental confirmation

    • Specific cellular processes involving AF_0267 are unidentified

  • Regulatory Context:

    • Expression patterns under various conditions are poorly characterized

    • Promoter elements and regulatory mechanisms undefined

    • Position within regulatory networks unclear

    • Unlike HSR1 (AF1298), whose expression changes dramatically during heat shock, AF_0267's response to environmental changes remains uncharacterized

  • Evolutionary Context:

    • Relationship to proteins in other archaea and domains of life

    • Selection pressures driving AF_0267 evolution

    • Functional conservation across related species

    • Acquisition of thermostability features during evolution

  • Structural Determinants:

    • Three-dimensional structure not experimentally determined

    • Structure-function relationships uncharacterized

    • Molecular basis for potential thermostability undefined

    • Conformational dynamics under varying conditions unknown

  • Interaction Network:

    • Protein-protein interactions largely unknown

    • Potential DNA/RNA binding specificity undetermined

    • Interaction dynamics under stress conditions unexplored

    • Integration with broader cellular processes unclear

Addressing these knowledge gaps requires a coordinated research effort employing multiple complementary approaches, prioritizing investigations that connect molecular characteristics with physiological roles in the unique context of a hyperthermophilic archaeon.

What research roadmap would most efficiently advance our understanding of AF_0267?

A strategic research roadmap for AF_0267 would involve the following sequential and parallel investigations:

  • Phase 1: Fundamental Characterization (0-12 months)

    • Complete bioinformatic analysis to generate initial functional hypotheses

    • Express and purify optimized recombinant protein for structural studies

    • Determine three-dimensional structure using X-ray crystallography or cryo-EM

    • Develop antibodies or tagged versions for subsequent studies

    • Establish baseline biochemical properties (stability, oligomeric state)

  • Phase 2: Functional Investigation (6-24 months)

    • Conduct comprehensive enzyme activity screening

    • Perform DNA/RNA binding analysis if indicated by structural features

    • Identify interaction partners through pulldown and mass spectrometry

    • Characterize expression under various physiological conditions

    • Begin development of genetic manipulation tools for A. fulgidus

  • Phase 3: Physiological Integration (18-36 months)

    • Create and characterize gene knockout/knockdown strains

    • Perform transcriptomic and proteomic comparison of wild-type and mutant strains

    • Analyze phenotypic consequences under various growth conditions

    • Map regulatory networks involving AF_0267

    • Develop mechanistic models of AF_0267 function

  • Phase 4: Evolutionary and Applied Studies (30-48 months)

    • Conduct comparative analysis across archaea and other domains

    • Perform directed evolution to probe structure-function relationships

    • Explore biotechnological applications based on identified functions

    • Develop synthetic biology applications utilizing AF_0267 properties

    • Integrate findings into broader understanding of archaeal biology

This research roadmap emphasizes building from molecular characterization to systems-level understanding, with parallel tracks of fundamental and applied research. The approach is designed to maximize efficiency by ensuring that each phase builds upon and informs subsequent investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.