Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0399 (AF_0399)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AF_0399; Uncharacterized protein AF_0399
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0399
Target Protein Sequence
MTNTDNMSPNFLRNAFRRLTITAIAPIVMTFEPFFIFPVVLITLARRGFVYILLPITAAL ILRATKVNYGPLTVSPTMHFNTPSIAVFAVLLVATTIASVFKPKLWRAFLVAIVVISILH AATPIESPVKGEGCNKISIELLDSETNFCFYISSAKTGKMWYYHATLHFMDSEGLVVNRV HLLTAALTFSSEVVEFRNEQGKFHAIFYSEVPIDSLKLKLCYFPETVIGSLPVVFCSSVD LEVR
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0399

STRING: 224325.AF0399

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the genomic context of AF_0399 in Archaeoglobus fulgidus?

AF_0399 is one of the 2,410 open reading frames identified in the Archaeoglobus fulgidus genome. While specific information about AF_0399 is limited in current literature, genomic context analysis typically involves examining neighboring genes, as seen with other A. fulgidus proteins where operon structures provide functional insights. For example, AF1298 was found to be part of an operon with two downstream genes (AF1297 and AF1296) that encode a small heat shock protein and an AAA+ ATPase respectively . Researchers should examine whether AF_0399 exists in isolation or as part of a potential operon structure, as this may provide initial functional hints.

How does AF_0399 compare to other uncharacterized proteins in hyperthermophilic archaea?

Comparison requires multiple sequence alignment tools like BLAST to identify homologs across archaeal species. For context, studies on A. fulgidus have identified proteins with varied expression profiles during heat shock, including both characterized and uncharacterized ORFs . When analyzing uncharacterized proteins like AF_0399, researchers should examine sequence conservation across thermophilic, hyperthermophilic, and mesophilic archaea to identify potential functional domains. If AF_0399 shows sequence similarity to proteins like HSR1 (AF1298), which contains a helix-turn-helix DNA binding motif, this could suggest potential DNA-binding functions .

What bioinformatic approaches are recommended for initial characterization of AF_0399?

Initial characterization should employ a multi-tool approach:

  • Domain prediction using InterProScan5 to identify protein domains and functional sites

  • Structural prediction using tools like AlphaFold

  • Functional annotation using Funannotate, which can identify Pfam domains, CAZYmes, and secreted proteins

  • GO ontology and transcription factor prediction if running InterProScan5

  • COG assignments and annotation using Eggnog-mapper

These tools collectively provide a foundation for hypothesis generation about the potential function of uncharacterized proteins like AF_0399. Funannotate specifically parses protein-coding models for comprehensive functional annotation, generating information about domains, secretion signals, and potential enzymatic activities .

What are the optimal conditions for recombinant expression of AF_0399?

Based on protocols used for other A. fulgidus proteins, consider these methodological approaches:

  • Expression system selection: E. coli has been successfully used for recombinant expression of A. fulgidus proteins, as demonstrated with HSR1 (AF1298) . Use BL21(DE3) or Rosetta strains for proteins with rare codons.

  • Temperature optimization: Since A. fulgidus is hyperthermophilic, expression at elevated temperatures (30-37°C) may improve folding, but initial tests should include lower temperatures (16-25°C) to prevent inclusion body formation.

  • Induction parameters: Test IPTG concentrations (0.1-1.0 mM) and induction times (3-16 hours) to optimize soluble protein yield.

  • Solubility enhancement: Consider fusion tags (MBP, SUMO, GST) if solubility is problematic, as hyperthermophilic proteins can misfold in mesophilic expression systems.

A methodical optimization approach is essential, as expression conditions successful for one A. fulgidus protein may not apply to all.

What purification strategy is most effective for obtaining high-purity AF_0399?

Develop a multi-step purification strategy:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) with a His-tag is the most common first step, using buffers containing 20-50 mM Tris-HCl (pH 7.5-8.0), 300-500 mM NaCl.

  • Heat treatment: Exploit the thermostability of A. fulgidus proteins by including a heat treatment step (65-85°C for 10-30 minutes), which often eliminates many E. coli contaminant proteins while preserving the hyperthermophilic target protein.

  • Secondary purification: Ion exchange chromatography based on the theoretical pI of AF_0399, followed by size exclusion chromatography.

  • Quality assessment: Verify purity by SDS-PAGE (>95%) and identity by mass spectrometry.

This strategy parallels successful purification of other A. fulgidus proteins like HSR1, which was purified to homogeneity from E. coli for downstream functional analyses .

What methods are most appropriate for determining the structure of AF_0399?

Consider this hierarchical approach to structural characterization:

  • Computational prediction: Begin with AlphaFold2 or RoseTTAFold to generate initial structural models, particularly valuable for understudied proteins like AF_0399.

  • Circular dichroism (CD) spectroscopy: Determine secondary structure composition and thermal stability, critical for hyperthermophilic proteins. Test stability at various temperatures (25-95°C) and pH values (4-9).

  • X-ray crystallography: For atomic-level resolution, screen crystallization conditions emphasizing conditions successful for other archaeal proteins (typically higher salt concentrations and temperatures 18-22°C).

  • Nuclear magnetic resonance (NMR): If protein size permits (<25 kDa), consider NMR for solution structure and dynamics.

  • Cryo-electron microscopy: For larger assemblies or if crystallization proves challenging.

The hierarchical approach allows resourceful progress while crystallization conditions are being optimized, similar to structural studies on other A. fulgidus proteins.

How can structural information help deduce the function of AF_0399?

Structural data provides multiple insights:

  • Structural homology: Compare obtained structures to known protein folds using tools like DALI or FATCAT. For context, structural analysis of HSR1 (AF1298) revealed a helix-turn-helix DNA binding motif, which guided functional studies on its DNA-binding properties .

  • Active site identification: Look for conserved residue clusters and pocket formations that may indicate catalytic sites or binding interfaces.

  • Domain architecture: Identify functional domains that may not be apparent from sequence alone, similar to how the DNA-binding domain in HSR1 guided experimental design .

  • Molecular dynamics simulations: Examine flexibility and potential conformational changes, particularly important for proteins functioning in high-temperature environments.

  • Electrostatic surface mapping: Identify potential nucleic acid or protein interaction interfaces.

This approach enables hypothesis-driven functional studies based on structural features.

What approaches can determine if AF_0399 has DNA/RNA binding activity?

Employ these methodological approaches:

  • Electrophoretic mobility shift assays (EMSA): Test binding to various DNA/RNA sequences, as performed successfully with HSR1 from A. fulgidus. Start with promoter regions of genes showing similar expression patterns .

  • DNase I footprinting: If EMSA shows positive results, follow with footprinting to identify specific binding sequences, as was done to identify the CTAAC-N5-GTTAG motif for HSR1 .

  • Systematic evolution of ligands by exponential enrichment (SELEX): For unbiased identification of binding motifs if no candidate sequences are apparent.

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC): Determine binding kinetics and thermodynamics at various temperatures.

  • Chromatin immunoprecipitation followed by sequencing (ChIP-seq): For in vivo binding site identification if heterologous expression systems are available.

This systematic approach has successfully identified DNA-binding activity and specific recognition sequences for other initially uncharacterized A. fulgidus proteins .

How can transcriptomic data guide functional hypothesis development for AF_0399?

Transcriptomic analysis provides contextual information:

  • Expression correlation analysis: Identify genes with similar expression patterns to AF_0399 across different conditions. For reference, whole-genome microarray studies of A. fulgidus identified co-regulated genes during heat shock, revealing functional relationships and potential operons .

  • Differential expression analysis: Determine conditions where AF_0399 shows significant regulation. If AF_0399 shows heat shock induction patterns similar to the 11 significantly induced genes identified in previous studies, this may suggest involvement in stress response pathways .

  • Time-course studies: Analyze expression dynamics over time, as temporal patterns may indicate involvement in specific cellular processes. Previous studies documented maximum expression at different time points following heat shock (5 minutes for some genes, followed by reduction over 55 minutes) .

  • Cross-species comparison: Examine expression of homologs in related species to identify conserved regulation patterns.

  • Network analysis: Place AF_0399 in gene co-expression networks to identify potential functional modules.

This approach can reveal potential biological processes involving AF_0399, particularly if it shows expression patterns similar to characterized heat shock genes in A. fulgidus .

How can protein-protein interaction studies reveal the functional network of AF_0399?

Implement these advanced methodological approaches:

  • Pull-down assays with recombinant AF_0399: Use purified AF_0399 as bait to identify interaction partners from A. fulgidus lysate, followed by mass spectrometry identification.

  • Bacterial/yeast two-hybrid systems: For systematic screening of binary interactions, though modifications may be needed to account for the thermophilic nature of the protein.

  • Proximity-labeling techniques: BioID or APEX2 fusion proteins can identify proximal proteins in cellular context.

  • Crosslinking mass spectrometry (XL-MS): Captures transient interactions and provides structural constraints.

  • Co-immunoprecipitation with antibodies against AF_0399: For validation of interactions in native context.

Analysis should focus on whether AF_0399 interacts with proteins in known stress response pathways, similar to how functional insights were gained for other A. fulgidus proteins through their association with heat shock proteins .

What CRISPR-based approaches can validate AF_0399 function in vivo?

CRISPR-based functional validation faces challenges in archaea but can be approached systematically:

Table 1: CRISPR-based approaches for functional validation in Archaeoglobus fulgidus

MethodTechnical ApproachAdvantagesLimitationsExpected Outcomes
Gene knockoutCRISPR-Cas9 targeted deletionDefinitive phenotype assessmentTechnical difficulty in A. fulgidus transformationGrowth defects or stress sensitivity if essential
CRISPRidCas9-based transcriptional repressionTunable repression for essential genesLower efficiency in archaeaPartial phenotypes revealing functional importance
CRISPRadCas9-based transcriptional activationGain-of-function analysisSystem needs customization for archaeaEnhanced stress response if involved in protection
Base editingTargeted mutation of specific residuesPrecise functional mappingRequires prediction of key residuesStructure-function relationships
Prime editingPrecise genomic modificationsFlexible editing capabilitiesNot yet established in archaeaDetailed functional analysis

Researchers must develop genetic tools specific to A. fulgidus, as CRISPR systems optimized for other archaea may require adaptation. Focus validation experiments on conditions where AF_0399 shows differential expression, particularly heat shock conditions similar to those used in previous studies .

How can comparative analysis across extremophiles enhance understanding of AF_0399 function?

Implement this cross-species analytical framework:

  • Phylogenetic profiling: Trace the evolutionary history of AF_0399 across archaea, particularly comparing hyperthermophiles to mesophiles. This approach identified evolutionary relationships between HSR1 and Phr of Pyrococcus furiosus, suggesting a diverse protein family involved in heat shock regulation .

  • Functional complementation: Express AF_0399 in model organisms or other archaea with mutations in genes of known function to test for phenotypic rescue.

  • Domain conservation analysis: Identify which domains of AF_0399 are conserved across species with different environmental adaptations.

  • Adaptation signatures: Look for signatures of positive selection in protein sequences that might indicate adaptive functions in extreme environments.

  • Comparative structural biology: Compare structures of homologs from organisms with different temperature optima to identify thermostability determinants.

This evolutionary perspective can reveal whether AF_0399 represents a thermophile-specific adaptation or serves a conserved function across diverse archaeal lineages .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.