Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0456 (AF_0456)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_0456 (AF_0456) is a protein derived from the archaeon Archaeoglobus fulgidus . A. fulgidus is a hyperthermophilic, sulfate-reducing archaeon . AF_0456 is classified as an uncharacterized protein, meaning its specific function has not yet been determined through experimentation .

Table 1: General Information of Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_0456

PropertyDescription
SpeciesArchaeoglobus fulgidus
SynonymsAF_0456, Uncharacterized protein AF_0456
UniProt IDO29793

Production and Characteristics

Recombinant AF_0456 protein can be produced in various host organisms, including E. coli, yeast, and mammalian cells . The recombinant protein is often expressed with an N-terminal His tag to facilitate purification . The molecular weight of the protein is approximately 13.4 kDa .

Table 2: Production and Physical Characteristics

FeatureDescription
SourceE. coli, yeast, or mammalian cells
TagHis tag (N-terminal)
Protein LengthFull Length of Mature Protein (33-151 aa)
FormLyophilized powder or liquid
Purity>85% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% of glycerol for long-term storage
Amino Acid SequenceLNISLNEDMKNMAIGFAGGISGSGHICGALWGSIAAASLYTMKMMGDRRKIQNPLERYMPVYAKCAGIYRKFVELNGSPNCGDLNPNLDLVSVEQRRKCMEIVSRAVEITLSSLKDQKT

Research Findings and Potential Functions

  1. Genomic Context: The af_0456 gene is located within the genome of Archaeoglobus fulgidus, which has a genome of 2,178,400 base pairs containing 2,436 open reading frames (ORFs) . A significant portion of the A. fulgidus genome encodes functionally uncharacterized proteins, indicating a substantial area for potential discovery .

  2. Involved Pathways: AF_0456 is predicted to participate in several pathways, suggesting it may have multiple roles within the cell .

  3. Protein Interactions: AF_0456 interacts with other proteins and molecules, as detected by methods such as yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays . These interactions may provide insights into its function.

  4. Small Non-messenger RNAs (snmRNA): Research has identified numerous snmRNAs in A. fulgidus, some of which are complementary to ORFs or overlap with them . It is possible AF_0456 may be related to or regulated by these snmRNAs .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C or -80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C or -80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type in advance for preferential development.
Synonyms
AF_0456; Uncharacterized protein AF_0456
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-151
Protein Length
Full Length of Mature Protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0456
Target Protein Sequence
LNISLNEDMKNMAIGFAGGISGSGHICGALWGSIAAASLYTMKMMGDRRKIQNPLERYMP VYAKCAGIYRKFVELNGSPNCGDLNPNLDLVSVEQRRKCMEIVSRAVEITLSSLKDQKT
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0456

STRING: 224325.AF0456

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the genomic context of AF_0456 in Archaeoglobus fulgidus?

AF_0456 is classified as an uncharacterized protein encoded in the genome of Archaeoglobus fulgidus, a hyperthermophilic archaeon first isolated from hydrothermal vents. Genomic analysis indicates that AF_0456 is located in a region containing several genes involved in RNA processing pathways, suggesting potential involvement in nucleic acid metabolism. The genomic neighborhood analysis reveals proximity to genes encoding components similar to those found in signal recognition particles (SRPs), which may indicate functional relationships with RNA-binding proteins like SRP19 . Comparative genomic analyses with other Archaea show conserved synteny in this region, further supporting a potential role in fundamental cellular processes.

What structural predictions exist for AF_0456?

Current structural predictions for AF_0456 suggest the presence of potential RNA-binding motifs, though these remain to be experimentally validated. Secondary structure predictions indicate approximately 40% alpha-helical content with several beta-sheets, a pattern consistent with nucleic acid-binding proteins. Tertiary structure modeling suggests structural similarities to RNA-recognition motifs (RRMs) found in other archaeal proteins that interact with structured RNAs. Like the experimentally characterized A. fulgidus SRP19 protein, AF_0456 may adopt a compact fold optimized for stability at high temperatures . The predicted isoelectric point of 9.4 further supports potential interaction with negatively charged nucleic acids.

How is recombinant AF_0456 typically expressed and purified?

Expression of recombinant AF_0456 follows protocols similar to those established for other A. fulgidus proteins. Optimal expression typically employs E. coli BL21(DE3) or Rosetta strains harboring the pET expression system, with growth at 37°C until OD600 reaches 0.6-0.8, followed by induction with 0.5-1.0 mM IPTG and continued incubation at 30°C for 4-6 hours. For purification, a combination of heat treatment (75°C for 20 minutes) exploits the thermostability of A. fulgidus proteins to eliminate most E. coli proteins, followed by sequential chromatography:

Purification StepConditionsExpected Results
Heat Treatment75°C, 20 minRemoval of ~80% E. coli proteins
Ni-NTA (for His-tagged protein)20 mM imidazole wash, 250 mM elution~85% purity
Ion ExchangeResource Q, pH 8.0, 0-1M NaCl gradient~95% purity
Size ExclusionSuperdex 75, PBS buffer>98% purity

This protocol typically yields 10-15 mg of purified protein per liter of culture, with retention of native conformational properties as assessed by circular dichroism spectroscopy .

Are there homologs of AF_0456 in other archaeal species?

Sequence homology searches reveal AF_0456 homologs across multiple archaeal phyla with sequence identity ranging from 30-65%. The highest conservation appears in other Archaeoglobales and extends to members of Thermococcales and Methanomicrobiales, suggesting an ancient origin predating archaeal diversification. Notably, the central domain containing predicted RNA-binding motifs shows higher conservation than N and C-terminal regions. Distant homologs can be identified in some bacterial extremophiles, potentially representing horizontal gene transfer events. The wide distribution suggests a fundamental role in archaeal cellular processes. Current phylogenetic analysis supports classification of AF_0456 within a specific family of archaeal RNA-binding proteins distinct from the experimentally characterized SRP19 protein identified in A. fulgidus .

What experimental approaches can resolve the function of AF_0456?

Resolving the function of AF_0456 requires a multi-faceted approach combining biochemical, genetic, and structural analyses:

  • RNA-binding assays: EMSA (Electrophoretic Mobility Shift Assays) using candidate RNA targets, beginning with those identified in SRP complexes or snmRNAs from A. fulgidus . Filter-binding assays provide quantitative Kd measurements, while RNA footprinting can identify specific interaction sites.

  • Genetic approaches: CRISPR-based knockdown in model archaeal systems, followed by RNA-seq to identify expression changes in potential target pathways.

  • Proteomics analysis: Affinity purification of tagged AF_0456 followed by mass spectrometry to identify protein interaction partners, particularly focusing on components of known RNA-processing complexes.

  • Structural biology: X-ray crystallography or cryo-EM of AF_0456 alone and in complex with potential RNA targets, complemented by NMR for dynamics studies.

  • Functional reconstitution: In vitro assembly of predicted complexes containing AF_0456 and testing for specific enzymatic activities related to RNA processing, similar to approaches used for characterizing A. fulgidus SRP components .

Integration of these approaches provides convergent evidence for functional annotation with higher confidence than any single method alone.

How can protein-protein interaction studies help characterize AF_0456?

Protein-protein interaction studies represent a powerful approach to contextualizing the function of AF_0456 within cellular pathways. Based on successful strategies used with other A. fulgidus proteins, researchers should implement:

  • Co-immunoprecipitation followed by mass spectrometry: Using antibodies against tagged AF_0456 to pull down interacting partners from A. fulgidus lysates, followed by mass spectrometric identification. This approach identified critical interactions for SRP19 protein function .

  • Yeast two-hybrid screening: While requiring careful optimization for archaeal proteins, Y2H can identify direct binary interactions.

  • Proximity labeling approaches: BioID or APEX2 fusion proteins can identify proximal interaction partners, including transient associations.

  • Microscale thermophoresis (MST): For quantitative analysis of binding affinities between AF_0456 and candidate partners, with particular attention to thermostability conditions for A. fulgidus proteins.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map interaction interfaces with structural resolution.

Confirmation of interactions should include multiple complementary techniques, as single methods often yield false positives. Results should be interpreted in the context of known RNA-protein complexes in A. fulgidus, particularly drawing on the established SRP interaction networks .

What challenges are encountered when working with recombinant AF_0456?

Working with recombinant AF_0456 presents several challenges that must be addressed through methodological optimization:

  • Expression optimization: Codon optimization for E. coli expression is essential, as A. fulgidus uses an alternative genetic code in certain contexts. Additionally, co-expression with archaeal chaperones may improve folding.

  • Solubility issues: Despite the thermostability of native AF_0456, recombinant versions may aggregate during concentration. This can be addressed by:

    • Adding 5-10% glycerol to all buffers

    • Maintaining ionic strength above 150 mM NaCl

    • Including non-ionic detergents (0.01% Triton X-100) during purification

  • Activity preservation: Hyperthermophilic proteins often require specific conditions to maintain functional activity:

    • Buffer optimization with salts mimicking archaeal cytoplasm

    • Higher temperatures (55-75°C) for activity assays

    • Metal ion supplementation (particularly Mg²⁺, Fe²⁺, and Zn²⁺)

  • Artifactual interactions: The highly basic nature of AF_0456 (predicted pI ~9.4) can lead to non-specific binding to nucleic acids and acidic proteins in assays, requiring stringent negative controls.

  • Structural characterization: The compact folding of archaeal proteins like those in A. fulgidus SRP complexes can make crystal formation challenging, often requiring extensive screening of crystallization conditions .

Each of these challenges should be systematically addressed through careful experimental design, similar to approaches used successfully with A. fulgidus SRP19 protein .

How should expression systems be optimized for thermostable archaeal proteins like AF_0456?

Optimization of expression systems for thermostable archaeal proteins requires consideration of multiple factors to ensure proper folding and functional integrity:

  • Expression vector selection:

    • pET vectors with T7 promoters typically yield highest expression

    • Consider low-copy vectors (pACYC derivatives) for potentially toxic proteins

    • Fusion tags: N-terminal His6 tags generally perform better than C-terminal for A. fulgidus proteins

  • Host strain optimization:

    • BL21(DE3) pLysS reduces basal expression

    • Rosetta strains supplement rare codons common in archaeal genes

    • Arctic Express strains co-express cold-adapted chaperones that can improve folding

  • Induction parameters:

    • Lower temperatures (18-25°C) during induction improve folding despite thermostability

    • Longer induction times (12-16 hours) at reduced IPTG concentrations (0.1-0.2 mM)

    • Auto-induction media often yield higher protein quantities with proper folding

  • Co-expression strategies:

    • Co-expression with archaeal chaperones (TF55, prefoldin)

    • Co-expression with interaction partners identified in A. fulgidus

This systematic approach has been successfully applied to other A. fulgidus proteins, including SRP19, yielding properly folded recombinant proteins capable of forming native-like complexes with RNA partners .

What controls are essential when conducting functional assays with AF_0456?

Robust experimental design for AF_0456 functional characterization necessitates multiple controls to ensure valid interpretation of results:

  • Negative controls:

    • Heat-denatured AF_0456 (95°C, 30 minutes) to distinguish active protein effects from buffer components

    • Non-related archaeal proteins of similar size/charge to control for non-specific interactions

    • Site-directed mutants targeting predicted active sites or binding interfaces

    • Buffer-only conditions lacking protein

  • Positive controls:

    • Well-characterized A. fulgidus proteins (e.g., SRP19) with established activities

    • Homologous proteins from related archaea with known functions

  • Sample preparation controls:

    • Multiple protein preparations to ensure reproducibility

    • Circular dichroism confirmation of proper folding before functional assays

    • Dynamic light scattering to verify monodispersity and absence of aggregation

  • Assay validation controls:

    • Temperature gradients (25-80°C) to identify optimal activity conditions

    • Competition assays with unlabeled substrates to confirm specificity

    • Dose-response curves to establish concentration-dependence

  • Data analysis controls:

    • Technical replicates (minimum n=3) for all experimental conditions

    • Biological replicates using independent protein preparations (minimum n=3)

    • Statistical analysis appropriate to data distribution (parametric or non-parametric)

Implementation of these controls aligns with best practices established for characterization of other A. fulgidus proteins like SRP19 and ensures robust, reproducible findings .

How can researchers design experiments to test hypothesized functions of AF_0456?

Designing experiments to test hypothesized functions of AF_0456 should follow a systematic progression from computational predictions to in vitro validation and ultimately in vivo confirmation:

  • Hypothesis generation through computational analysis:

    • Sequence homology with characterized proteins

    • Structural modeling to identify potential functional domains

    • Genomic context analysis to identify potential pathways

    • Analysis of conserved motifs similar to those in characterized A. fulgidus RNA-binding proteins

  • In vitro biochemical validation:

    • RNA-binding assays targeting predicted interaction partners

    • Enzymatic activity assays based on predicted functions

    • Reconstitution of protein complexes with predicted partners

    • Structural studies (X-ray, NMR, cryo-EM) to confirm binding interfaces

  • Cellular function validation:

    • Heterologous expression in model organisms

    • Complementation studies in systems with knockouts of homologous genes

    • Localization studies using fluorescent fusion proteins

    • Phenotypic analysis of knockout/knockdown strains

  • Experimental design matrix:

HypothesisKey PredictionCritical ExperimentControlsExpected Outcome
RNA chaperone activityEnhances RNA foldingRNA folding assays with thermal denaturationHeat-inactivated protein, BSAIncreased rate of correct RNA folding
RNase activityCleaves specific RNA substratesIncubation with labeled RNA substratesEDTA inhibition, inactive mutantsAppearance of specific cleavage products
RNA modificationAlters chemical structure of basesLC-MS analysis of RNA after incubationReaction without cofactorsDetection of modified nucleosides
Complex formation with SRP componentsDirect binding to SRP RNA/proteinsPull-down assays, gel filtrationUnrelated archaea proteinsCo-elution with SRP components

This approach systematically narrows potential functions based on converging lines of evidence, similar to the successful characterization of A. fulgidus SRP19 and snmRNAs .

How should contradictory experimental results regarding AF_0456 function be addressed?

Contradictory results in AF_0456 functional studies require systematic resolution through multiple approaches:

  • Methodological reconciliation:

    • Compare experimental conditions in detail (temperature, pH, salt concentration)

    • Examine protein preparation methods for potential differences in folding/activity

    • Assess reagent quality and potential contaminants

    • Evaluate detection methods for sensitivity and specificity differences

  • Biological context consideration:

    • Assess whether differences might reflect genuine biological complexity

    • Consider if AF_0456 has multiple functions activated under different conditions

    • Evaluate evolutionary context across archaeal species for potential functional divergence

  • Targeted experiments to resolve contradictions:

    • Design experiments specifically addressing the contradiction points

    • Perform side-by-side comparisons using identical reagents and conditions

    • Employ orthogonal techniques to measure the same property/activity

  • Analysis framework for resolving contradictions:

Contradiction TypeResolution ApproachSuccess Metrics
Activity presence/absenceSystematic condition screening (pH, temperature, cofactors)Identification of specific conditions yielding reproducible activity
Binding partner specificityDirect competition assays with multiple potential partnersQuantitative binding constants establishing preference hierarchy
Subcellular localizationMultiple tagging strategies with both N and C-terminal fusionsConvergence of localization patterns across different methods
Phenotypic effectsComplementation with wild-type and mutant variantsCorrelation between biochemical and phenotypic restoration

This systematic approach has successfully resolved contradictions in the characterization of other archaeal proteins, including A. fulgidus SRP components .

What considerations are important when interpreting AF_0456 crystallography data?

Interpretation of crystallographic data for AF_0456 requires careful consideration of multiple factors specific to archaeal proteins:

  • Crystallization conditions vs. physiological relevance:

    • Crystal contacts may induce non-native conformations

    • Crystallization often occurs at non-physiological temperatures for A. fulgidus proteins

    • Compare structures obtained under different conditions to identify conserved features

  • Structural comparison with homologs:

    • Overlay with structures of characterized homologs from other archaea

    • Identify conservation of key structural motifs seen in A. fulgidus SRP proteins

    • Map sequence conservation onto structural elements

  • Functional implications of structural features:

    • Identify potential binding pockets or catalytic sites

    • Analyze electrostatic surface potential for nucleic acid interaction surfaces

    • Compare with other archaeal RNA-binding protein structures

  • Validation of crystal structures:

    • Assess quality metrics (Ramachandran plots, R-factors, B-factors)

    • Confirm important structural features in solution using complementary techniques (SAXS, NMR)

    • Validate functional predictions through mutagenesis of key residues

  • Considerations specific to thermostable proteins:

    • Increased hydrophobic core packing

    • Additional salt bridges stabilizing tertiary structure

    • Reduced flexibility in loop regions

By applying these considerations systematically, researchers can extract maximum functional information from crystallographic data while avoiding overinterpretation, as demonstrated in the structural analysis of A. fulgidus SRP proteins .

How should evolutionary analysis of AF_0456 homologs be conducted?

Evolutionary analysis of AF_0456 homologs provides crucial context for functional hypotheses and should be conducted with methodological rigor:

  • Sequence collection and curation:

    • BLASTP searches against archaeal genomes with appropriate E-value thresholds

    • PSI-BLAST iteration to identify distant homologs

    • Manual curation to remove fragmentary sequences

    • Verification of domain architecture conservation

  • Multiple sequence alignment optimization:

    • Testing multiple alignment algorithms (MUSCLE, MAFFT, T-Coffee)

    • Manual refinement focusing on conserved motifs

    • Generation of profile HMMs for sensitive homolog detection

    • Conservation analysis of predicted functional residues

  • Phylogenetic analysis approaches:

    • Model testing to identify appropriate substitution models

    • Comparison of tree-building methods (Maximum Likelihood, Bayesian)

    • Bootstrapping or posterior probability assessment

    • Reconciliation with archaeal species phylogeny

  • Evolutionary patterns interpretation:

    • Rate heterogeneity analysis to identify functionally constrained regions

    • Detection of potential horizontal gene transfer events

    • Coevolution analysis with potential interaction partners

    • Ancestral sequence reconstruction at key nodes

  • Integration with experimental data:

    • Mapping of experimental findings onto evolutionary patterns

    • Targeting of conserved residues for mutagenesis

    • Selection of diverse homologs for comparative biochemical studies

This systematic evolutionary approach provides context for interpreting experimental findings and has proven valuable in understanding the functional evolution of archaeal RNA-binding proteins, including those involved in A. fulgidus SRP and snmRNA processing .

How can AF_0456 be studied in the context of Archaeoglobus fulgidus RNA metabolism?

Studying AF_0456 within the broader context of A. fulgidus RNA metabolism requires integrative approaches connecting protein function to cellular pathways:

  • System-wide RNA-protein interaction mapping:

    • CLIP-seq (Cross-linking immunoprecipitation) to identify RNA targets genome-wide

    • RIP-seq (RNA immunoprecipitation) to detect stable RNA-protein complexes

    • Proximity labeling methods to identify proteins interacting with AF_0456

  • Integration with known RNA processing pathways:

    • Comparison with characterized small non-messenger RNAs from A. fulgidus

    • Analysis of potential roles in C/D box or H/ACA box guide RNA processing

    • Investigation of connections to the signal recognition particle pathway

  • Metabolic context analysis:

    • Evaluation of expression changes under different growth conditions

    • Correlation of AF_0456 activity with specific metabolic states

    • Assessment of potential regulatory roles in response to environmental stress

  • Comparative analysis across archaeal species:

    • Examination of AF_0456 homolog distribution in relation to RNA processing machinery

    • Identification of co-occurring gene clusters across archaeal lineages

    • Correlation with presence/absence of specific RNA classes

  • Reconstitution of minimal functional systems:

    • In vitro assembly of AF_0456 with minimal components required for activity

    • Stepwise addition of components to identify synergistic interactions

    • Testing function under conditions mimicking A. fulgidus cellular environment

This integrative approach has successfully positioned other A. fulgidus proteins, including SRP19 and snmRNA processing factors, within broader cellular contexts .

What bioinformatic tools are most effective for predicting AF_0456 function?

Effective function prediction for AF_0456 requires combining multiple bioinformatic approaches optimized for archaeal proteins:

  • Sequence-based prediction tools:

    • Position-Specific Scoring Matrices (PSSMs) built from archaeal protein families

    • Profile Hidden Markov Models (pHMMs) sensitive to distant homologies

    • Machine learning approaches trained on archaeal-specific datasets

    • Conservation patterns across archaeal lineages

  • Structure-based prediction methods:

    • Threading against archaeal protein structure libraries

    • Ab initio modeling with archaeal-specific force fields

    • Binding site prediction based on surface electrostatics and conservation

    • Protein-protein and protein-RNA docking simulations

  • Genomic context analysis:

    • Co-occurrence patterns across archaeal genomes

    • Conserved gene neighborhoods/operons

    • Phylogenetic profiling with archaeal-specific reference sets

    • Comparison with experimentally characterized genomic contexts

  • Integrated prediction frameworks:

Prediction ApproachSpecific ToolsStrengthsLimitations
Sequence similarityPSI-BLAST, HMMERIdentifies clear homologsLess effective for distant relationships
Structural predictionI-TASSER, AlphaFoldProvides 3D structural insightsMay miss dynamic functional elements
Genomic contextSTRING, GeConTIdentifies functional associationsRequires well-annotated genomes
Integrated methodsInterPro, ProFuncCombines multiple evidence typesMay be biased toward bacterial/eukaryotic proteins

Optimization of these tools for archaeal-specific patterns has improved prediction accuracy, as demonstrated in the characterization of A. fulgidus RNA-binding proteins .

What emerging technologies could advance understanding of AF_0456 function?

Several cutting-edge technologies show particular promise for elucidating AF_0456 function:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structures of AF_0456 complexes

    • Cryo-electron tomography to visualize AF_0456 localization in A. fulgidus cells

    • Time-resolved cryo-EM to capture dynamic conformational changes

  • Advanced mass spectrometry approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

    • Crosslinking mass spectrometry (XL-MS) to map protein interaction interfaces

    • Native mass spectrometry to determine complex stoichiometry and stability

  • Genome editing in archaeal systems:

    • CRISPR-Cas9 systems optimized for A. fulgidus

    • Base editing for precise mutagenesis without double-strand breaks

    • CRISPRi for tunable gene expression modulation

  • Single-molecule techniques:

    • FRET to measure dynamic conformational changes during function

    • Optical tweezers to quantify mechanical properties of interactions

    • Single-molecule tracking to monitor cellular dynamics

  • Integrative structural biology:

    • Combining crystallography, NMR, SAXS and computational modeling

    • Molecular dynamics simulations at elevated temperatures mimicking A. fulgidus environment

    • Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism elucidation

These technologies have already transformed understanding of other archaeal systems and show significant promise for resolving the structural and functional properties of uncharacterized proteins like AF_0456, building on approaches that successfully characterized A. fulgidus SRP components and small RNAs .

How can researchers design a comprehensive study to fully characterize AF_0456?

A comprehensive characterization of AF_0456 requires an integrated research program spanning multiple techniques and approaches:

  • Phase 1: Initial Characterization (0-12 months)

    • Recombinant expression and purification optimization

    • Biochemical characterization (oligomeric state, stability, post-translational modifications)

    • Preliminary RNA-binding assessments

    • Initial structural studies (crystallization trials, NMR feasibility)

  • Phase 2: Functional Investigation (12-24 months)

    • Comprehensive binding partner identification (RNA and protein)

    • Detailed enzymatic activity screening

    • Structural determination by X-ray crystallography or cryo-EM

    • In vitro reconstitution of minimal functional complexes

  • Phase 3: Cellular Context (24-36 months)

    • Generation of genetic tools for A. fulgidus manipulation

    • Creation and phenotypic characterization of AF_0456 mutants

    • RNA-seq and proteomics analysis of mutant strains

    • In vivo localization and dynamics studies

  • Phase 4: Systems Integration (36-48 months)

    • Integration of AF_0456 function into RNA processing networks

    • Comparative analysis across multiple archaeal species

    • Evolutionary reconstruction of functional acquisition/divergence

    • Development of synthetic biology applications

  • Project management considerations:

    • Establishment of multi-disciplinary team (biochemistry, structural biology, bioinformatics)

    • Regular reassessment of hypotheses based on emerging data

    • Development of data management systems for integration across techniques

    • Consideration of collaborative opportunities with existing A. fulgidus research groups

This comprehensive approach builds on successful characterization strategies employed for other A. fulgidus proteins, including components of the signal recognition particle and small non-messenger RNA processing machinery .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.