Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0488 (AF_0488)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_0488 (AF_0488)

Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_0488 (AF_0488) is a full-length, His-tagged recombinant protein derived from the thermophilic archaeon Archaeoglobus fulgidus. With a UniProt accession number O29762, this protein spans 106 amino acids (1–106) and remains functionally uncharacterized in current literature. It is primarily produced in E. coli using recombinant DNA technology, though alternative expression systems (e.g., yeast, mammalian cells) have also been reported .

Expression Systems

Host SystemProduct CodeKey Features
E. coliRFL6671AF, CSB-EP518156DOC1High yield, His-tagged, >90% purity
YeastCSB-YP518156DOC1Alternative expression for post-translational modifications
Mammalian CellsCSB-MP518156DOC1Used for complex folding or glycosylation studies

Purification and Handling

  • Purification Method: Affinity chromatography (His-tag) followed by SDS-PAGE validation .

  • Reconstitution: Suspend in deionized sterile water (0.1–1.0 mg/mL), add 5–50% glycerol for long-term storage .

  • Storage: -20°C/-80°C; avoid repeated freeze-thaw cycles .

Current Status

AF_0488 remains uncharacterized, with no established biochemical or physiological roles. While structural homology to other archaeal proteins (e.g., AAA ATPase family members) has been proposed, experimental validation is lacking .

Hypothetical Functions

  • Chaperone Activity: Analogous to A. fulgidus AMA (a AAA ATPase), which prevents protein aggregation via ATP-dependent mechanisms .

  • Protein Interactions: Potential involvement in pathways related to thermal stress or protein folding, though no direct evidence exists .

Research Challenges

  • Limited Biochemical Data: No reported enzymatic assays, substrate binding studies, or crystallographic structures.

  • Expression Variability: Alternative hosts (e.g., yeast) may yield distinct post-translational modifications, requiring comparative studies .

Potential Research Applications

ApplicationRationale
Structural BiologyCrystallization studies to elucidate quaternary structure or domain interactions .
Protein Interaction NetworksYeast-two-hybrid or co-IP assays to identify binding partners .
Therapeutic DevelopmentScreening for chaperone-like activity in misfolded protein models .

Recommended Research Priorities

  1. Functional Screens: ATPase activity assays, thermal stability tests, or aggregation prevention assays.

  2. Phylogenetic Analysis: Comparative studies with homologs in methanogenic archaea to infer evolutionary roles.

  3. High-Throughput Interactome Mapping: Leveraging A. fulgidus genomic databases to predict interactors .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
AF_0488; Uncharacterized protein AF_0488
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0488
Target Protein Sequence
MKRLIFVIGVFIVALALSAFHWVGIIIGGLIVGYFSKNLKEAVAAGLALSLFIFGAFLAY LAYMGMLEKFLTLSPLPYISILLCMALAVISATITNFFSPFAVKQS
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0488

STRING: 224325.AF0488

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant in genomic research?

Archaeoglobus fulgidus is a hyperthermophilic, sulphate-metabolizing archaeon that holds significant importance in microbial genomics. It was the first sulphur-metabolizing organism to have its genome completely sequenced, containing 2,178,400 base pairs with 2,436 open reading frames (ORFs) . The organism demonstrates extensive correlation with Methanococcus jannaschii in information processing systems and biosynthetic pathways for essential components, while showing marked differences in environmental sensing, regulatory functions, and energy acquisition mechanisms .

Research significance:

  • Approximately 25% (651 ORFs) of the A. fulgidus genome encodes functionally uncharacterized yet conserved proteins

  • Two-thirds of these uncharacterized proteins (428 ORFs) are shared with M. jannaschii

  • Another quarter of the genome encodes entirely new proteins, indicating substantial archaeal gene diversity

This genomic diversity makes A. fulgidus an important model organism for understanding archaeal biology and evolution.

What is currently known about AF_0488 protein structure and characterization?

AF_0488 is classified as an uncharacterized protein from Archaeoglobus fulgidus with limited structural and functional characterization. The protein consists of 106 amino acid residues in its full-length form . Available recombinant forms typically include a His-tag for purification purposes, with the E. coli expression system being the predominant source for producing the recombinant protein .

Current characterization status:

  • Full amino acid sequence is known (106 amino acids)

  • Available in recombinant form with His-tag

  • Lacks comprehensive structural data (no published crystal structure)

  • Function remains undetermined

  • Protein-protein interactions and pathway involvement remain largely unexplored

The lack of functional characterization places AF_0488 among the significant portion of A. fulgidus proteins (approximately 25%) that remain functionally uncharacterized yet conserved .

How can researchers express and purify recombinant AF_0488 for laboratory studies?

Expression and purification of recombinant AF_0488 follows established methodologies for thermophilic archaeal proteins, with specific adaptations:

Expression protocol:

  • Clone the AF_0488 gene into an expression vector (e.g., pETDuet) with an N-terminal His-tag

  • Transform into E. coli expression strain BL21(DE3)

  • Grow cells in LB broth with appropriate antibiotics at 37°C until A600 reaches 0.5

  • Lower incubation temperature to 16°C and induce with 0.1 mM IPTG

  • Continue incubation for approximately 16 hours at 16°C

  • Harvest cells by centrifugation

Purification considerations:

  • Implement heat treatment (70-80°C) to leverage the thermostable nature of AF_0488 and eliminate E. coli host proteins

  • Utilize immobilized metal affinity chromatography (IMAC) with Ni-NTA resin for His-tagged protein purification

  • Consider size exclusion chromatography as a polishing step

  • Buffer optimization typically requires thermostability considerations (e.g., inclusion of reducing agents and salt concentrations appropriate for thermophilic proteins)

This methodology is based on established protocols for other A. fulgidus proteins, such as AfAgo, and can be adapted specifically for AF_0488 .

What computational approaches can predict the potential function of AF_0488?

Predicting the function of uncharacterized proteins like AF_0488 requires a multi-faceted computational approach:

Sequence-based analysis:

  • Homology detection using PSI-BLAST and HHpred against diverse protein databases

  • Identification of conserved domains using Pfam, SMART, and CDD

  • Analysis of conserved residues and motifs that might indicate functional sites

  • Phylogenetic profiling to understand evolutionary conservation patterns

Structural prediction and analysis:

  • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

  • Structural comparison with known protein folds using DALI or VAST

  • Binding site prediction using SiteMap, CASTp, or FTMap

  • Molecular dynamics simulations to identify stable conformations

Integrative approaches:

  • Gene neighborhood analysis to identify functionally related genes

  • Gene expression correlation analysis from transcriptomic data

  • Protein-protein interaction prediction using STRING or STITCH

  • Metabolic context analysis using pathway databases like KEGG

Given that approximately 25% of A. fulgidus proteins remain functionally uncharacterized yet conserved , these computational approaches provide a systematic foundation for experimental validation of AF_0488's function.

How might AF_0488 interact with known sulfur metabolism pathways in Archaeoglobus fulgidus?

Investigating AF_0488's potential role in sulfur metabolism requires understanding the established sulfur metabolism pathways in A. fulgidus and examining possible interactions:

Key sulfur metabolism proteins in A. fulgidus:

ProteinFunctionPotential Relationship to AF_0488
DsrABDissimilatory sulfite reductaseCould form complex or regulatory relationship
DsrCSulfite reductase subunitPotential interaction partner
DsrMKJOPMembrane complex for electron transferCould be regulated by or interact with AF_0488
AprAAdenosine-5′-phosphosulfate reductaseMay share regulatory mechanisms
HmeC/DsrMMenaquinol-oxidizing enzymePotential metabolic relationship

Investigation approaches:

  • Co-expression analysis to detect correlation with known sulfur metabolism genes

  • Protein-protein interaction studies using pull-down assays with tagged AF_0488

  • Proximity labeling techniques (BioID or APEX) to identify proteins in close proximity to AF_0488

  • Analysis of expression changes in AF_0488 under varying sulfur conditions

  • Structural modeling to predict potential binding interfaces with sulfur metabolism proteins

The clustered organization of genes related to sulfate respiration in A. fulgidus provides context for examining AF_0488's genomic neighborhood for clues to functional relationships .

What experimental approaches can definitively determine if AF_0488 forms homodimers like other A. fulgidus proteins?

Determining the oligomeric state of AF_0488 requires multiple complementary biophysical techniques, especially considering that other A. fulgidus proteins like AfAgo have been shown to form functionally important homodimers :

Size determination techniques:

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine absolute molecular weight

  • Analytical ultracentrifugation (AUC) for sedimentation velocity and equilibrium analysis

  • Native PAGE to compare migration patterns with known molecular weight standards

Structural techniques:

  • Small-angle X-ray scattering (SAXS) to determine solution structure and oligomeric state

  • X-ray crystallography to resolve potential dimerization interfaces

  • Cryo-electron microscopy for structural determination of larger assemblies

Interaction-specific techniques:

  • Crosslinking mass spectrometry to identify interaction interfaces

  • Single-molecule FRET to detect conformational changes upon dimerization

  • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

  • Atomic force microscopy (AFM) to visualize oligomeric complexes

These approaches would mirror successful methodologies used to characterize the homodimerization of AfAgo, which forms substantial dimerization interfaces involving C-terminal β-sheets .

What are the optimal buffer conditions for maintaining stability of recombinant AF_0488?

Developing optimal buffer conditions for thermostable archaeal proteins like AF_0488 requires careful consideration of multiple factors:

Buffer composition recommendations:

ComponentRecommended RangeRationale
pH7.0-8.0Matches physiological pH of A. fulgidus
NaCl300-500 mMPromotes stability of thermophilic proteins
Reducing agent1-5 mM DTT or TCEPPrevents unwanted disulfide formation
Divalent cations1-10 mM MgCl₂May be required for structural stability
Glycerol5-10%Enhances protein stability during storage
Protease inhibitorsPMSF, EDTA, or cocktailPrevents degradation during purification

Stability testing protocol:

  • Perform thermal shift assays (Thermofluor) to determine melting temperature (Tm) in various buffer conditions

  • Conduct time-course stability studies at different temperatures (4°C, 25°C, 37°C, and 70-80°C)

  • Assess activity or structural integrity after freeze-thaw cycles

  • Evaluate long-term storage stability at -80°C with different cryoprotectants

Given the hyperthermophilic nature of A. fulgidus, which grows optimally at temperatures around 83°C, AF_0488 likely exhibits substantial thermal stability, potentially requiring specialized conditions for proper folding and function .

How can researchers design experiments to identify potential nucleic acid interactions of AF_0488?

Given that other A. fulgidus proteins like AfAgo demonstrate DNA/RNA-binding capabilities, investigating potential nucleic acid interactions of AF_0488 requires a systematic experimental approach:

Screening for nucleic acid interactions:

  • Electrophoretic mobility shift assays (EMSA) with various DNA/RNA substrates:

    • Single-stranded DNA/RNA of different lengths

    • Double-stranded DNA with varying GC content

    • Structured nucleic acids (hairpins, G-quadruplexes)

    • Circular DNA to detect topological preferences

  • Filter binding assays to determine binding affinities (Kd values)

  • Fluorescence anisotropy to measure binding kinetics

Characterizing binding specificity:

  • Systematic evolution of ligands by exponential enrichment (SELEX) to identify preferred binding sequences

  • Nuclease protection assays to map binding sites

  • Crosslinking and immunoprecipitation (CLIP) followed by sequencing to identify in vivo binding sites

Structural characterization of complexes:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding interfaces

  • X-ray crystallography or cryo-EM of protein-nucleic acid complexes

  • NMR spectroscopy for dynamic interaction analysis

These approaches are particularly relevant given that AfAgo, another A. fulgidus protein, forms homodimers and interacts with DNA in a manner that suggests potential involvement in homologous recombination or host defense mechanisms .

What strategies can overcome the challenges of crystallizing uncharacterized proteins like AF_0488?

Crystallizing uncharacterized proteins presents unique challenges that require specialized approaches:

Pre-crystallization optimization:

  • Protein construct optimization:

    • Create multiple constructs with varying N- and C-terminal boundaries

    • Remove potential flexible regions predicted by disorder prediction algorithms

    • Consider surface entropy reduction (SER) by mutating clusters of high-entropy residues (Lys, Glu) to alanine

  • Protein quality assessment:

    • Analytical SEC to ensure monodispersity

    • Dynamic light scattering (DLS) to verify homogeneity

    • Thermal shift assays to identify stabilizing conditions

Crystallization strategies:

  • High-throughput screening:

    • Implement sparse matrix screens covering diverse crystallization conditions

    • Utilize thermal gradient approaches to find temperature-dependent crystallization

  • Alternative crystallization methods:

    • Lipidic cubic phase (LCP) for membrane-associated proteins

    • Counter-diffusion for slow, controlled crystallization

    • Seeding techniques to promote crystal growth from pre-existing nuclei

  • Crystallization with partners:

    • Co-crystallization with antibody fragments

    • Use of crystallization chaperones (e.g., MBP, SUMO)

    • Addition of small-molecule ligands identified through thermal shift assays

These strategies have proven successful for structural studies of other archaeal proteins and would be applicable to uncharacterized proteins like AF_0488.

How does AF_0488 compare to other uncharacterized proteins in hyperthermophilic archaea?

Comparative analysis of AF_0488 with other uncharacterized archaeal proteins provides evolutionary and functional context:

Comparative features:

FeatureAF_0488Other Uncharacterized Archaeal ProteinsImplications
Size106 amino acidsTypically larger (150-300 aa)May represent a minimal functional domain
ConservationPresent in select archaeaVarying conservation patternsCould indicate specialized vs. core functions
Genomic contextNeed to analyze neighborsOften found in operonsMay suggest functional associations
Predicted structureNeed structural predictionOften contain thermostable motifsCould help identify functional class
HomologyLimited sequence homologySome show homology to bacterial proteinsMay indicate horizontal gene transfer

Research approaches:

  • Phylogenetic profiling across archaeal species to identify co-evolution patterns

  • Analysis of genomic context conservation across species

  • Comparative structural prediction to identify conserved folds

  • Expression pattern comparison under stress conditions

  • Analysis of taxonomic distribution to determine evolutionary history

This comparative approach leverages the knowledge that approximately 25% of the A. fulgidus genome encodes functionally uncharacterized yet conserved proteins, with two-thirds shared with M. jannaschii, providing a framework for understanding the potential role of AF_0488 .

What role might AF_0488 play in the adaptation of Archaeoglobus fulgidus to extreme environments?

Investigating AF_0488's potential role in extremophile adaptation requires examining multiple stress response mechanisms:

Potential adaptation roles:

  • Thermostability mechanisms:

    • Analysis of amino acid composition for thermostable features (high proportion of charged residues, low in thermolabile residues)

    • Evaluation of potential disulfide bonds or salt bridges that could enhance stability

    • Examination of hydrophobic core packing and surface hydration

  • Stress response involvement:

    • Expression analysis under various stressors (temperature, pH, salt, oxidative stress)

    • Interaction studies with known stress response proteins

    • Analysis of post-translational modifications under stress conditions

  • DNA/RNA protection mechanisms:

    • Assessment of nucleic acid binding capabilities under extreme conditions

    • Evaluation of potential chaperoning activity for nucleic acids

    • Testing for nucleic acid repair-related functions

Experimental approaches:

  • Differential expression analysis of AF_0488 under varying growth conditions

  • Gene knockout or knockdown studies to assess survival under stress conditions

  • Heterologous expression in mesophilic hosts to evaluate conferred stress resistance

  • Structural analysis at different temperatures to identify stabilizing features

Understanding AF_0488's role in extreme adaptation is particularly relevant given A. fulgidus' status as a hyperthermophile that grows optimally at temperatures around 83°C in anaerobic conditions .

How can researchers design a comprehensive functional genomics pipeline to characterize AF_0488?

A systematic functional genomics approach combines multiple technologies to comprehensively characterize uncharacterized proteins like AF_0488:

Integrated characterization pipeline:

  • Computational phase:

    • Sequence analysis (conserved domains, motifs, predicted structure)

    • Genomic context analysis (operons, regulons, synteny)

    • Protein-protein interaction network prediction

    • Metabolic pathway gap analysis

  • Experimental phase:

    • Targeted gene knockout using CRISPR-Cas systems adapted for archaea

    • Phenotypic profiling under various growth conditions

    • Transcriptomic analysis comparing wild-type and knockout strains

    • Affinity purification-mass spectrometry to identify interaction partners

    • Metabolomic profiling to detect metabolic changes upon knockout

  • Structural and biochemical characterization:

    • Protein purification and stability optimization

    • Activity screening against diverse substrates

    • Structural determination through X-ray crystallography or cryo-EM

    • In vitro reconstitution of potential pathways or complexes

  • Validation phase:

    • Complementation studies with wild-type and mutant variants

    • Heterologous expression in model organisms

    • In vivo localization studies using fluorescent tags

    • Site-directed mutagenesis of predicted functional residues

This comprehensive approach is necessary for fully characterizing the 25% of A. fulgidus proteins that remain functionally uncharacterized yet conserved, including AF_0488 .

What are the most promising research directions for understanding AF_0488 function?

Based on current knowledge about A. fulgidus biology and related proteins, several high-priority research directions emerge:

  • Structural determination through X-ray crystallography or cryo-EM to provide foundational insights into potential function

  • Protein-protein interaction studies to identify binding partners, with special attention to known sulfur metabolism proteins given A. fulgidus' classification as a sulphur-metabolizing organism

  • Nucleic acid interaction studies, particularly relevant given that other A. fulgidus proteins like AfAgo demonstrate DNA/RNA-binding capabilities that suggest roles in host defense or homologous recombination

  • Genetic manipulation through development of knockout or knockdown systems to observe phenotypic effects under various growth conditions

  • Comparative genomics focusing on the 25% of functionally uncharacterized yet conserved proteins in A. fulgidus, examining patterns of co-conservation that might reveal functional relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.