Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0712 (AF_0712)

What are the fundamental properties of Archaeoglobus fulgidus Uncharacterized protein AF_0712?

AF_0712 is a 116-amino acid protein (UniProt ID: O29546) from the hyperthermophilic archaeon Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126). The complete amino acid sequence is: MRRLAILLSLAGIADSSYLLLSEAVPCPTGVCASISVFSLPPFVPALLGLCWFVLSIVVFTAGVNRALLTFWRFSGVFGESFLGTYAVLHGYFCPYCFTAYGIGIVVVAISEKLYG . Analysis of this sequence reveals the presence of two cysteine residues in a CXXC motif (YFCPYCF) that may be involved in metal binding or redox activity. The protein contains hydrophobic regions suggesting possible membrane association or integration.

What expression systems are most effective for producing recombinant AF_0712?

Recombinant AF_0712 has been successfully produced in E. coli expression systems with N-terminal His-tag fusion for purification purposes . When expressing this archaeal protein in bacterial systems, researchers should optimize codon usage for E. coli and consider temperature modulation during induction to enhance proper folding. For functional studies, expression in archaeal host systems might provide more native-like post-translational modifications, though bacterial expression is sufficient for initial structural characterization. Purification yields of greater than 90% purity can be achieved as determined by SDS-PAGE analysis when using affinity chromatography with His-tag binding resins .

What are the optimal storage and handling conditions for recombinant AF_0712?

Recombinant AF_0712 should be stored as aliquots at -20°C/-80°C to minimize damage from repeated freeze-thaw cycles. For short-term use, working aliquots can be maintained at 4°C for up to one week . The protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, addition of glycerol to a final concentration of 5-50% is recommended, with 50% being optimal for many applications . Prior to opening, vials should be briefly centrifuged to bring contents to the bottom. When handling the protein, maintain sterile conditions and use low-binding tubes to prevent protein loss through adsorption.

What bioinformatic approaches can predict the structural features of AF_0712?

For uncharacterized proteins like AF_0712, a multi-tiered bioinformatic approach should be employed. Begin with sequence-based tools such as BLAST for homology detection, followed by more sensitive methods like HHpred or HMMER to identify remote homologs. For structural prediction, AlphaFold2 and RoseTTAFold can generate high-confidence 3D models, especially valuable for proteins lacking experimental structures. The presence of the CXXC motif (YFCPYCF) in AF_0712 suggests potential metal-binding capabilities or thiol-disulfide oxidoreductase activity, warranting focused analysis of this region .

What experimental techniques are most appropriate for determining the tertiary structure of AF_0712?

Given AF_0712's relatively small size (116 amino acids), a combination of experimental approaches is recommended for structural determination. X-ray crystallography remains the gold standard if the protein can be crystallized, potentially requiring screening of various crystallization conditions optimized for membrane-associated proteins if the bioinformatic predictions suggest membrane interaction.

Nuclear Magnetic Resonance (NMR) spectroscopy is particularly suitable for this smaller protein and can provide dynamic information along with structure. For NMR studies, expression protocols should be adapted to incorporate 15N and 13C labeling. Cryo-electron microscopy (cryo-EM), while typically used for larger complexes, has advancing capabilities for smaller proteins when coupled with scaffolding techniques.

For challenging cases, integrative structural biology approaches combining limited proteolysis with mass spectrometry, small-angle X-ray scattering (SAXS), and hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide valuable structural constraints. These experimental data should be combined with computational modeling to refine structural predictions.

How can researchers interpret circular dichroism (CD) spectra of AF_0712 to assess secondary structure stability?

Circular dichroism provides valuable information about the secondary structure composition and thermal stability of proteins like AF_0712. Far-UV CD spectra (190-260 nm) should be collected at different temperatures to assess the proportion of α-helices, β-sheets, and random coils. For interpretation, use deconvolution software such as SELCON3, CDSSTR, or BeStSel that employ reference protein sets.

When analyzing CD data for AF_0712, compare spectra under various pH conditions and salt concentrations to identify optimal stability parameters. Given AF_0712 comes from a hyperthermophile, perform thermal denaturation studies from 25°C to 95°C to establish the melting temperature (Tm) and assess the degree of cooperative folding. Analysis should include monitoring the signal at 222 nm (α-helix) and 215 nm (β-sheet) during temperature ramping.

The protein's archaeal origin suggests potential extraordinary thermal stability, which should be compared to mesophilic homologs if identified. Researchers should also consider measuring CD spectra in the presence of potential cofactors or metals that might bind to the CXXC motif to assess ligand-induced conformational changes.

What methods can be employed to determine the potential membrane association of AF_0712?

Based on the hydrophobic regions identified in the sequence, AF_0712 may associate with membranes . To experimentally validate this prediction, researchers should employ a multi-faceted approach. Membrane fractionation studies using ultracentrifugation can separate soluble, peripheral, and integral membrane proteins. Western blotting of these fractions using anti-His antibodies can detect the recombinant AF_0712 and determine its localization pattern.

Further investigation may include phase separation assays using Triton X-114, which separates hydrophobic from hydrophilic proteins. For more detailed topology analysis, researchers should consider accessibility studies using membrane-impermeable reagents that modify exposed protein regions, followed by mass spectrometry analysis. Fluorescence techniques such as FRET or advanced microscopy with fluorescently labeled AF_0712 in liposome systems can provide dynamic information about membrane interactions.

The experimental results should be compared with computational predictions to refine the structural model and identify specific membrane-interacting domains within AF_0712.

How can researchers investigate the potential role of the CXXC motif in AF_0712's function?

The CXXC motif (YFCPYCF) in AF_0712 suggests potential involvement in redox reactions, metal binding, or disulfide bond formation . To investigate this functionally important motif, researchers should employ site-directed mutagenesis to create variants where one or both cysteines are substituted with serine. Comparative analysis of wild-type and mutant proteins using activity assays, structural studies, and stability measurements can reveal the motif's contribution to function and folding.

Metal binding capabilities should be assessed through inductively coupled plasma mass spectrometry (ICP-MS) after extensive dialysis, or by isothermal titration calorimetry (ITC) with various metals. For redox activity investigation, researchers should measure the redox potential of the CXXC motif using electrochemical methods and evaluate thiol-disulfide exchange activity with model substrates.

Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify conformational changes around the CXXC motif under different redox conditions or in the presence of potential interaction partners, providing insights into the motif's functional importance.

What omics approaches are valuable for predicting the physiological role of AF_0712?

For uncharacterized proteins like AF_0712, integrating multiple omics datasets can provide contextual information about its physiological role. Transcriptomic analysis should examine AF_0712 expression patterns under various growth conditions (temperature, pH, electron acceptors) to identify regulatory patterns. Co-expression analysis can reveal genes with similar expression profiles, suggesting functional relationships.

Proteomics approaches such as proximity labeling (BioID or APEX) can identify proteins physically close to AF_0712 in vivo. Pull-down assays followed by mass spectrometry can identify direct interaction partners. For system-level understanding, metabolomic profiling comparing wild-type and AF_0712 knockout/overexpression strains can reveal affected metabolic pathways.

Researchers should leverage comparative genomics to identify conserved genomic context (synteny) across related species, which often indicates functional relationships. Phylogenetic profiling can identify proteins with similar evolutionary patterns, suggesting related functions. These multi-omics approaches should be integrated computationally to develop testable hypotheses about AF_0712's role in Archaeoglobus fulgidus physiology.

How should researchers design experiments to investigate AF_0712 function under hyperthermophilic conditions?

When investigating AF_0712 from the hyperthermophile Archaeoglobus fulgidus, experimental designs must account for the extreme conditions in which this protein naturally functions. All activity assays should be conducted across a temperature range that includes the optimal growth temperature of A. fulgidus (approximately 83°C) as well as lower temperatures for comparison. Specialized equipment such as high-temperature spectrophotometers and thermostable cuvettes or microplates are essential.

Buffer systems must maintain pH stability at high temperatures, with PIPES, HEPES, or phosphate buffers being suitable choices when properly concentration-adjusted for temperature effects. Researchers should include thermostable controls in all experiments and consider oxygen sensitivity, as A. fulgidus is an anaerobic organism. Anaerobic chambers or sealed reaction vessels purged with nitrogen or argon should be utilized.

The experimental design should incorporate appropriate positive controls using well-characterized thermostable proteins and negative controls with mesophilic homologs if available. Time-course experiments are particularly important as reaction kinetics may differ significantly at elevated temperatures.

What statistical approaches are most appropriate for analyzing contradictory experimental results regarding AF_0712?

When faced with contradictory results in AF_0712 research, researchers should first ensure that experimental conditions are truly comparable before applying statistical analyses. For quantitative measurements, paired statistical tests should be employed when analyzing the same samples under different conditions. For complex datasets, multifactorial ANOVA can disentangle the effects of multiple variables (temperature, pH, salt concentration) on AF_0712 function .

Researchers should avoid arbitrary significance thresholds (such as p < 0.05) and instead report exact p-values together with effect sizes to provide a more complete picture of experimental outcomes . For seemingly contradictory results, meta-analytical approaches can integrate data from multiple experiments, weighted by sample size and methodological quality.

Bayesian statistical methods are particularly valuable when prior information exists about AF_0712 or related proteins, as they can incorporate this knowledge into the analysis framework. When reporting results, researchers should clearly distinguish between exploratory and confirmatory analyses, with appropriate statistical corrections for multiple comparisons in exploratory work.

How can researchers design appropriate control experiments when studying an uncharacterized protein like AF_0712?

For uncharacterized proteins like AF_0712, designing appropriate controls is particularly challenging but essential. Negative controls should include buffer-only conditions and, when possible, a related protein with a different predicted function. For site-directed mutagenesis studies targeting the CXXC motif, include both alanine substitutions (removing function) and conservative substitutions (e.g., cysteine to serine) to distinguish between structural and functional effects.

Positive controls should utilize well-characterized proteins with similar predicted functions or structural features when available. If the CXXC motif in AF_0712 suggests thioredoxin-like activity, include a known thioredoxin in parallel experiments. For activity assays, incorporate internal standards and calibration curves with known quantities.

Researchers should also implement procedural controls that account for potential experimental artifacts, such as testing for metal contamination in assay components when investigating metal binding properties. When using recombinant proteins, compare different expression constructs (varying tags, tag positions, or tag-free versions) to ensure that observed properties are intrinsic to AF_0712 rather than artifacts of the recombinant system.

How can researchers integrate structural and functional data to develop a comprehensive model of AF_0712?

Developing a comprehensive model of AF_0712 requires systematic integration of diverse experimental data. Researchers should begin by mapping functional data onto the predicted or experimentally determined structure, identifying structure-function relationships. This integration can reveal how the CXXC motif and hydrophobic regions contribute to the protein's biochemical properties.

Molecular dynamics simulations can bridge static structural information with dynamic functional data, simulating protein behavior under various conditions including high temperatures relevant to A. fulgidus. These simulations should incorporate experimental constraints from techniques like crosslinking mass spectrometry or FRET to enhance accuracy.

Network analysis approaches can integrate protein-protein interaction data with structural information, positioning AF_0712 within its biological context. When developing these integrative models, researchers should clearly distinguish between experimentally validated components and predictions, assigning confidence levels to different aspects of the model. The final model should generate testable hypotheses for further experimental validation, creating an iterative refinement process.

What machine learning approaches can predict potential interaction partners for AF_0712?

Machine learning offers powerful tools for predicting protein-protein interactions for uncharacterized proteins like AF_0712. Sequence-based models utilizing convolutional neural networks can identify potential binding motifs within the AF_0712 sequence. Structure-based approaches employing geometric deep learning can analyze surface features that may participate in protein-protein interactions.

These computational predictions should integrate multiple data types, including co-expression patterns, phylogenetic profiles, and domain composition similarities. Transfer learning approaches are particularly valuable, allowing models trained on well-characterized protein-protein interactions to inform predictions about archaeal proteins with limited experimental data.

For implementation, researchers should use established platforms like STRING-db or custom pipelines built with open-source libraries such as PyTorch or TensorFlow. All predictions should be assigned confidence scores and validated through targeted experimental approaches such as yeast two-hybrid screening, pull-down assays, or surface plasmon resonance with candidate interactors.

How can researchers effectively compare AF_0712 with other uncharacterized proteins to infer evolutionary relationships?

Comparative analysis of AF_0712 with other uncharacterized proteins requires sophisticated phylogenetic approaches beyond standard sequence comparison. Researchers should employ profile-based methods like PSI-BLAST or HMMER that can detect remote homologs where pairwise sequence alignment fails. Structure-based comparisons using tools like DALI or TM-align can identify structural similarities even when sequence conservation is minimal.

For evolutionary analysis, construct maximum likelihood phylogenetic trees using appropriate substitution models for archaeal proteins. Evaluation should include bootstrap analysis or Bayesian posterior probabilities to assess confidence in branching patterns. Investigation of conserved sequence motifs, particularly around the CXXC region, can provide insights into functional conservation across diverse species.

Researchers should also analyze patterns of coevolution within protein families using methods like direct coupling analysis (DCA) or mutual information approaches, which can reveal residues that have co-evolved due to functional or structural constraints. These analyses should be integrated with taxonomic distribution data to reconstruct the evolutionary history of AF_0712 and related proteins across archaeal lineages.

What are the potential biotechnological applications of thermostable proteins like AF_0712?

Thermostable proteins from hyperthermophiles like Archaeoglobus fulgidus hold significant biotechnological potential due to their inherent stability. If AF_0712 demonstrates redox activity through its CXXC motif, it could serve as a thermostable catalyst for industrial oxidation-reduction processes requiring high-temperature conditions . Applications might include biofuel production, where thermostable enzymes can operate at temperatures that reduce contamination risk.

The protein's potential membrane association suggests applications in designing thermostable biosensors or membrane protein scaffolds. If AF_0712 proves capable of maintaining structural integrity at high temperatures, it could serve as a molecular framework for engineering thermostability into mesophilic proteins through domain fusion or directed evolution approaches.

Researchers should explore AF_0712's compatibility with continuous flow processes in industrial settings, where thermostable proteins allow for higher reaction temperatures that increase substrate solubility and reaction rates while reducing microbial contamination. Any biotechnological application development should include comprehensive characterization of the protein's stability in organic solvents and in the presence of potential inhibitors.

How can CRISPR-Cas9 technology be applied to study the physiological role of AF_0712 in Archaeoglobus fulgidus?

CRISPR-Cas9 genome editing presents opportunities for functional genomics studies of AF_0712 in its native context. Researchers should design guide RNAs targeting the AF_0712 gene with careful consideration of archaeal-specific PAM requirements. For delivery, electroporation protocols optimized for the high-salt conditions preferred by A. fulgidus should be employed, with transformation efficiency monitored using selectable markers appropriate for this organism.

Genome editing strategies should include complete gene deletion to assess essentiality, domain-specific mutations targeting the CXXC motif, and promoter replacements to control expression levels. After genome modification, comprehensive phenotyping should be conducted, comparing growth rates, metabolic profiles, and transcriptional responses of mutant strains to the wild type under various conditions.

For challenging archaeal systems where direct CRISPR-Cas9 editing proves difficult, researchers should consider heterologous expression of AF_0712 in genetically tractable archaeal models like Sulfolobus species, allowing for functional studies in a related thermophilic context. Complementation studies, where mutant phenotypes are rescued by providing the wild-type gene, should be included to confirm that observed effects are specifically due to AF_0712 modification.

What interdisciplinary approaches would be most beneficial for understanding the role of uncharacterized proteins like AF_0712 in extremophile biology?

Understanding uncharacterized proteins like AF_0712 in extremophiles requires integration across multiple scientific disciplines. Combining structural biology with biophysical techniques can reveal how these proteins maintain stability and function under extreme conditions. Computational approaches from bioinformatics and systems biology should be applied to predict functional networks and metabolic roles.

Synthetic biology offers powerful tools for reconstructing minimal systems to test hypothesized functions in controlled environments. Ecological perspectives examining the environmental conditions of hydrothermal vents, where Archaeoglobus species thrive, can provide context for interpreting laboratory findings and suggesting relevant experimental conditions.

Researchers should establish interdisciplinary collaborations bringing together expertise in archaeal biology, protein biochemistry, and extreme environment geochemistry. Technological integration across fields, such as combining cryo-electron microscopy with mass spectrometry and computational modeling, can overcome individual methodological limitations. These interdisciplinary approaches should ultimately aim to place AF_0712 within the broader context of archaeal adaptation to extreme environments and archaeal contributions to biogeochemical cycles.