Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0761 (AF_0761)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_0761

Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_0761 (AF_0761) is a synthetic protein derived from the hyperthermophilic archaeon Archaeoglobus fulgidus. Originally identified as a genomic open reading frame (ORF) in A. fulgidus, this protein lacks a known biochemical function but is part of a conserved group of uncharacterized proteins in archaeal genomes . Its recombinant form is produced for research purposes, typically expressed in E. coli or mammalian cells, and is tagged for purification and stability .

Sequence and Expression

PropertyDetail
SpeciesArchaeoglobus fulgidus (strain VC-16/DSM 8774)
Source OrganismNative to hyperthermophilic environments (optimal growth: 76°C)
Expression HostE. coli (full-length) or mammalian cells (partial)
Protein LengthFull-length (1–105 amino acids) or partial
TagN-terminal His-tag (for E. coli-derived versions)
UniProt IDO29497

The amino acid sequence of the full-length E. coli-expressed protein is:
MENIMDEKGQMILLFAFVVVIVVLTLSYVYAQNIIAGVESSRAMLAFPKEEIRNLEEIQKNFGGDSEVNSQIQTLCAKNGWVCYVGVDKVEFKNVEVDYCAGSDC .

Biochemical Properties

PropertyDetail
Purity>90% (SDS-PAGE for E. coli-expressed) ; >85% (mammalian)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionLyophilized powder reconstituted in deionized water (0.1–1.0 mg/mL)
StabilityAliquots stored at -20°C/-80°C; avoid freeze-thaw cycles

Comparative Analysis of Recombinant Variants

FeatureE. coli-Expressed Mammalian-Expressed
Protein LengthFull-length (1–105 aa)Partial
TagHis-tagNot specified
Purity>90%>85%
Expression HostBacterial (high yield)Mammalian (eukaryotic folding)
ApplicationsStructural studies, enzyme assaysFunctional assays (if post-translational modifications required)

Functional Insights and Genome Context

AF_0761 belongs to a group of uncharacterized proteins in A. fulgidus that constitutes ~25% of its genome . While its specific role remains unknown, genomic comparisons with other archaea (e.g., Methanococcus jannaschii) suggest conserved regulatory or metabolic functions . Key insights include:

  • Genomic Location: Part of a 2.3 Mbp circular chromosome in A. fulgidus .

  • Conservation: Shared with other archaea, implying potential roles in core cellular processes .

Potential Uses

ApplicationRationale
Structural BiologyHis-tag facilitates crystallization studies of archaeal proteins
Enzyme AssaysTesting for uncharacterized catalytic activities (e.g., DNA repair)
Protein InteractionsIdentifying binding partners via pull-down or yeast two-hybrid

Limitations

  • Functional Elucidation: No direct evidence links AF_0761 to known pathways (e.g., BER) .

  • Expression Challenges: Mammalian-expressed variants may lack post-translational modifications critical for activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of that tag.
Synonyms
AF_0761; Uncharacterized protein AF_0761
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0761
Target Protein Sequence
MENIMDEKGQMILLFAFVVVIVVLTLSYVYAQNIIAGVESSRAMLAFPKEEIRNLEEIQK NFGGDSEVNSQIQTLCAKNGWVCYVGVDKVEFKNVEVDYCAGSDC
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0761

STRING: 224325.AF0761

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant for protein research?

Archaeoglobus fulgidus is a hyperthermophilic archaeon originally isolated from hot marine sediments near hydrothermal vents. It has an optimal growth temperature of 83°C and possesses the remarkable capability to couple the oxidation of various substrates (H₂, lactate, pyruvate, glucose, or complex organic compounds) to the reduction of sulfate to sulfide . The significance of A. fulgidus in protein research stems from its evolutionary position among the Archaea, particularly its relationship to methanogens. While it produces small amounts of methane during growth and contains traces of coenzymes typically found in methanogens, genome sequencing has revealed it lacks genes for a key enzyme of methanogenesis, methyl-CoM reductase . This unique evolutionary position makes its proteins particularly valuable for studying archaeal biochemistry.

The complete genome of A. fulgidus contains approximately 2,400 genes, with a significant portion being unique genes never before identified in other organisms . This extensive genetic diversity makes uncharacterized proteins like AF_0761 promising candidates for discovering novel biochemical functions and structural motifs that may provide insights into archaeal biology and potentially reveal new enzymatic capabilities relevant to biotechnological applications.

How are recombinant Archaeoglobus fulgidus proteins typically expressed and purified?

Recombinant A. fulgidus proteins are typically expressed in heterologous systems, with Escherichia coli being the most common expression host. For example, in studies of other A. fulgidus proteins, researchers have successfully used E. coli BL21codonplus(DE3)-RIL strains for protein expression . These strains are particularly useful as they contain extra copies of rare codons that may be present in archaeal genes but uncommon in E. coli.

A standard expression protocol involves:

  • Cloning the gene of interest into an expression vector (such as pET29b)

  • Transforming the construct into an appropriate E. coli strain

  • Growing the culture at 37°C until it reaches an optimal optical density (typically OD₆₀₀ of 1.0)

  • Inducing protein expression with isopropyl-β-D-thiogalactopyranoside (IPTG)

  • Harvesting cells after an appropriate incubation period (commonly 4 hours)

For purification, a typical workflow includes:

  • Cell lysis using a French press or sonication

  • Clarification of the lysate by centrifugation

  • Affinity chromatography (often using His-tagged proteins and Ni-NTA columns)

  • Further purification by ion exchange or size exclusion chromatography if needed

  • Buffer exchange to stabilize the purified protein

For thermostable proteins like those from A. fulgidus, a heat treatment step (e.g., 65-75°C for 10-15 minutes) is often included after cell lysis to precipitate most E. coli proteins while leaving the thermostable archaeal protein in solution, providing a significant initial purification advantage.

What are the general characteristics of uncharacterized proteins in Archaeoglobus fulgidus?

Uncharacterized proteins in A. fulgidus often possess several distinctive characteristics reflective of their hyperthermophilic origin. These include:

  • Thermostability: Proteins from A. fulgidus typically exhibit remarkable stability at high temperatures, often maintaining function at or above 80°C.

  • Unique structural features: Many archaeal proteins contain modifications that enhance thermostability, such as increased disulfide bonding, higher proportion of charged amino acids forming salt bridges, and compact hydrophobic cores.

  • Novel domains: Many uncharacterized proteins contain domains that are archaeal-specific or shared only with a limited number of other extremophiles.

  • Potential involvement in stress responses: Some uncharacterized proteins show differential expression under stress conditions. For example, the heat shock response of A. fulgidus involves changes in expression of 350 genes out of 2,410 genes, with 189 showing increased mRNA abundance and 161 showing decreased abundance .

  • DNA-binding capabilities: Some previously uncharacterized proteins from A. fulgidus have been found to possess DNA-binding properties and may play roles in gene regulation, as demonstrated with AF1298, which was shown to bind to heat shock-induced promoters .

Given these general characteristics, AF_0761 may possess similar properties and potentially function in stress response pathways or DNA/RNA metabolism, though specific functional characterization would be required to confirm this.

What expression systems are most suitable for recombinant Archaeoglobus fulgidus proteins?

While E. coli remains the most widely used expression system for A. fulgidus proteins due to its simplicity and cost-effectiveness, several factors should be considered when selecting an expression system for uncharacterized proteins like AF_0761:

Expression SystemAdvantagesLimitationsSuitability for AF_0761
E. coli BL21(DE3)Fast growth, high yield, simple protocolsMay not properly fold complex archaeal proteinsGood for initial trials
E. coli BL21codonplus(DE3)-RILContains extra copies of rare codonsMore expensive than standard strainsExcellent for archaeal proteins with rare codons
E. coli RosettaEnhanced disulfide bond formationLower yields than standard strainsGood for proteins with multiple disulfides
Yeast (Pichia pastoris)Post-translational modificationsLonger expression timeConsider if E. coli yields inactive protein
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldsUseful for preliminary functional studies

For most A. fulgidus proteins, including presumably AF_0761, the E. coli BL21codonplus(DE3)-RIL strain has proven effective, as demonstrated in the expression of other A. fulgidus proteins like AF1298 . The choice of expression vector is also important, with pET system vectors (such as pET29b) commonly used for archaeal proteins . These vectors place the gene of interest under control of the T7 promoter, allowing for high-level, inducible expression.

How can structural studies help determine the function of uncharacterized protein AF_0761?

Structural studies provide critical insights into protein function, particularly for uncharacterized proteins like AF_0761. Several approaches can be employed:

  • X-ray Crystallography: Determining the high-resolution crystal structure of AF_0761 would allow researchers to identify structural motifs and potential active sites. The thermostability of A. fulgidus proteins can be advantageous for crystallization, as they tend to be more conformationally stable.

  • Nuclear Magnetic Resonance (NMR): For smaller domains of AF_0761, NMR can provide information about protein dynamics and potential ligand binding sites.

  • Cryo-Electron Microscopy: Particularly useful if AF_0761 forms larger complexes with other proteins.

  • Structural Comparisons: Once the structure is determined, comparisons with known proteins using tools like DALI or VAST can identify structural homologs even when sequence similarity is low. For example, the archaeal macrodomain AF1521 from A. fulgidus has been identified as having highly selective recognition of ADP-ribose conjugated to proteins , a function that might not have been predicted from sequence alone.

  • In silico Docking: Computational screening of potential ligands or substrates based on the structural features of binding pockets.

A structured approach to determining the function of AF_0761 based on structural studies might include:

a) Expressing and purifying domains of AF_0761 using methods similar to those employed for other A. fulgidus proteins
b) Performing structural determination by X-ray crystallography or NMR
c) Identifying potential functional sites through structural analysis
d) Testing predicted functions through targeted biochemical assays

This approach has been successful with other A. fulgidus proteins, such as the macrodomain AF1521, which was structurally characterized and found to selectively recognize ADP-ribosylated proteins, leading to its application in detection methods for this post-translational modification .

What approaches can be used to identify protein-protein interactions involving AF_0761?

Understanding the interaction partners of AF_0761 could provide valuable clues about its biological function. Several complementary approaches can be employed:

  • Pull-down Assays: Using tagged recombinant AF_0761 as bait to identify interacting proteins from A. fulgidus cell extracts. This approach was successfully used with other A. fulgidus proteins, such as the clamp loader proteins .

  • Yeast Two-Hybrid (Y2H) Screening: While traditional Y2H may be challenging for archaeal proteins due to thermostability issues, modified systems have been developed for thermophilic proteins.

  • Bacterial Two-Hybrid Systems: These can be more suitable for archaeal proteins than Y2H and have been used successfully with other extremophile proteins.

  • Co-immunoprecipitation: If antibodies against AF_0761 are available or can be generated, they can be used to precipitate AF_0761 along with its interacting partners from cell lysates.

  • Crosslinking Mass Spectrometry: This technique can capture transient or weak interactions by crosslinking proteins in close proximity before mass spectrometric analysis.

  • Biolayer Interferometry or Surface Plasmon Resonance: These methods can be used to test direct interactions with specific candidate proteins and determine binding kinetics.

For example, researchers studying the RFC homologue from A. fulgidus demonstrated that the large and small subunits interact with PCNA (Proliferating Cell Nuclear Antigen), and this interaction is stimulated by ATP binding . Similar approaches could reveal whether AF_0761 interacts with components of DNA replication machinery, transcription factors, or other cellular systems.

How does heat shock affect the expression of uncharacterized proteins in Archaeoglobus fulgidus?

Heat shock response in A. fulgidus provides valuable insights into stress-responsive genes and their regulation. Studies using whole-genome microarrays have shown that heat shock induces significant changes in the expression of 350 genes out of 2,410 in the A. fulgidus genome, with 189 showing increased expression and 161 showing decreased expression over a 60-minute period .

Six genes previously annotated or predicted to be heat shock-related were induced within the first 5 minutes of heat shock (AF1296, AF1297, AF1298, AF1451, AF2238, and AF1971) . If AF_0761 shows similar expression patterns, it might indicate involvement in the heat shock response.

To investigate whether AF_0761 is involved in heat shock response:

  • Real-time RT-PCR: This can be used to quantify changes in AF_0761 expression levels during heat shock, using protocols similar to those described for other A. fulgidus genes .

  • Promoter Analysis: Examining the promoter region of AF_0761 for potential binding sites of heat shock regulators. For instance, researchers have identified that AF1298, a potential DNA-binding protein, interacts with heat shock-induced promoters .

  • Electrophoretic Mobility Shift Assays (EMSA): This can determine whether known heat shock transcription factors bind to the AF_0761 promoter region.

  • DNase I Footprinting: This can precisely identify binding sites of regulatory proteins on the AF_0761 promoter, as demonstrated for other heat shock-regulated genes in A. fulgidus .

A comprehensive analysis of AF_0761's potential role in heat shock response would involve correlating its expression patterns with known heat shock genes and identifying regulatory elements in its promoter region that respond to temperature changes.

What bioinformatic approaches can predict the function of AF_0761?

Given the limitations of experimental data for uncharacterized proteins, bioinformatic analyses provide valuable preliminary insights into potential functions:

  • Sequence Homology Analysis:

    • BLAST searches against various databases to identify homologs

    • Position-Specific Iterative BLAST (PSI-BLAST) to detect remote homologs

    • HMM-based searches using HMMER against protein family databases

  • Domain and Motif Prediction:

    • InterProScan to identify conserved domains

    • MOTIF Search to detect sequence patterns associated with specific functions

    • PROSITE for identifying functionally significant sites

  • Structural Prediction:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • I-TASSER for threading-based structural modeling

    • Comparison of predicted structures with known structures using DALI

  • Genomic Context Analysis:

    • Examination of neighboring genes, which often function in related pathways

    • Analysis of gene fusion events

    • Conservation of gene clustering across related species

  • Co-expression Network Analysis:

    • Identifying genes with similar expression patterns under various conditions

    • This is particularly relevant given the heat shock expression data available for A. fulgidus

  • Phylogenetic Profiling:

    • Determining the pattern of presence/absence of AF_0761 across species

    • Proteins with similar phylogenetic profiles often function in the same pathway

The integration of these various bioinformatic approaches can provide a multifaceted prediction of AF_0761's function, guiding subsequent experimental validation.

What are the optimal conditions for expressing and purifying recombinant AF_0761?

Based on protocols used for other A. fulgidus proteins, the following optimized conditions can be suggested for AF_0761:

Expression System Optimization:

ParameterRecommended ConditionsRationale
Expression HostE. coli BL21codonplus(DE3)-RILProvides rare codons common in archaeal genes
Expression VectorpET29b with C-terminal His-tagAllows for IPTG induction and affinity purification
Growth MediumLB with appropriate antibioticsStandard for high-level protein expression
Induction OD₆₀₀1.0Balance between cell density and expression efficiency
IPTG Concentration0.6 mMOptimal for many archaeal proteins
Induction Temperature30°CLower than growth temp. to enhance proper folding
Induction Time4-6 hoursSufficient for high-level protein accumulation

Purification Protocol:

  • Cell Harvesting and Lysis:

    • Resuspend cells in phosphate buffer (20 mM, pH 7.4) containing 0.5 M NaCl and 20 mM imidazole

    • Lyse cells using French press at 100 mPa

    • Centrifuge at 8,000 rpm for 10 min at 4°C

  • Heat Treatment (optional):

    • Incubate clarified lysate at 70°C for 15 minutes

    • Remove precipitated proteins by centrifugation

    • This step leverages the thermostability of A. fulgidus proteins

  • Affinity Chromatography:

    • Filter supernatant through a 0.22 μm filter

    • Load onto a HisTrap HP column

    • Wash with 5 column volumes of phosphate buffer

    • Elute with an imidazole gradient (100-400 mM)

  • Buffer Exchange:

    • Exchange to a storage buffer (e.g., 20 mM Tris, pH 7.6, 150 mM KCl, 0.5 mM MgCl₂, 10% glycerol) using a centrifugal filter

This protocol should be initially tested on a small scale and optimized as needed for AF_0761. Modifications might be necessary based on the specific properties of the protein, such as solubility or stability.

What techniques can be used to assess the functional activity of AF_0761?

Without prior knowledge of AF_0761's function, a systematic approach to functional characterization is necessary:

  • Binding Assays:

    • Nucleic Acid Binding: Electrophoretic Mobility Shift Assays (EMSA) and DNase I footprinting can determine if AF_0761 binds DNA or RNA, similar to techniques used for AF1298

    • Protein Binding: Pull-down assays, Far-Western blotting, or Surface Plasmon Resonance can identify protein interaction partners

    • Small Molecule Binding: Thermal shift assays or isothermal titration calorimetry to screen for potential ligands

  • Enzymatic Activity Screening:

    • ATPase/GTPase Activity: Test if AF_0761 hydrolyzes nucleotides, as observed in some A. fulgidus proteins like the RFC complex

    • Post-translational Modification Recognition: Test if AF_0761 recognizes specific modifications like ADP-ribosylation, similar to AF1521

    • Catalytic Activity: Screen for various enzymatic activities (hydrolase, transferase, etc.) using appropriate substrates

  • Structural Analysis:

    • Circular Dichroism to assess secondary structure content and thermal stability

    • Size-Exclusion Chromatography with Multi-Angle Light Scattering to determine oligomerization state

    • Hydrogen-Deuterium Exchange Mass Spectrometry to identify dynamic regions and potential binding sites

  • Cellular Localization:

    • If antibodies are available, immunofluorescence microscopy in heterologous systems

    • GFP-fusion proteins to track localization in live cells

  • Functional Complementation:

    • Test if AF_0761 can complement deletion mutants of homologous genes in model organisms

    • This approach requires identification of potential homologs through bioinformatic analysis

The results from these initial screens would guide more focused investigations into the specific function of AF_0761.

How can researchers design experiments to determine the biological role of AF_0761 in Archaeoglobus fulgidus?

A comprehensive strategy to elucidate the biological role of AF_0761 would integrate multiple approaches:

  • Expression Analysis:

    • Quantify expression levels of AF_0761 under various growth conditions (temperature, carbon source, growth phase)

    • Real-time RT-PCR can be used following protocols similar to those used for other A. fulgidus genes

    • Compare expression patterns with genes of known function to identify potential co-regulated pathways

  • Gene Knockout/Knockdown Studies:

    • Generate an AF_0761 deletion strain if genetic tools are available for A. fulgidus

    • CRISPR interference (CRISPRi) might be applicable for knockdown studies

    • Analyze phenotypic changes under various growth conditions

  • Protein-Protein Interaction Network:

    • Perform immunoprecipitation coupled with mass spectrometry to identify interaction partners

    • Validate key interactions using techniques such as bacterial two-hybrid systems or co-immunoprecipitation

    • Construct an interaction network to place AF_0761 in a functional context

  • Transcriptomics of Mutant Strains:

    • Compare transcriptome of wild-type and AF_0761 mutant strains

    • Identify differentially expressed genes that might be regulated by AF_0761

    • This approach proved valuable in understanding the heat shock response in A. fulgidus

  • In vivo Localization:

    • Develop fluorescently tagged versions of AF_0761

    • Determine subcellular localization under different conditions

    • Co-localization studies with known protein complexes

A well-designed experimental workflow might begin with expression analysis under various conditions to identify when AF_0761 is most active, followed by interaction studies to identify binding partners, and finally functional studies based on the insights gained from these initial investigations.

What controls should be included in experiments involving AF_0761?

For Expression and Purification:

  • Negative Control: E. coli transformed with empty vector to control for background protein expression

  • Positive Control: Well-characterized A. fulgidus protein expressed under the same conditions

  • Solubility Controls: Various buffer conditions to optimize protein solubility

  • Protease Inhibitor Controls: Samples with and without protease inhibitors to assess degradation

For Binding Assays:

  • Specificity Controls: Competition assays with unlabeled probes

  • Non-specific Binding Controls: Unrelated DNA/RNA sequences or proteins

  • Buffer Controls: Variations in salt concentration, pH, and cofactors

  • Heat-denatured AF_0761 as a negative control

  • Known DNA-binding proteins from A. fulgidus (such as AF1298) as positive controls for DNA-binding assays

For Functional Assays:

  • Substrate Specificity Controls: Structurally related substrates to test specificity

  • Enzyme Concentration Controls: Titration of AF_0761 to ensure linearity of response

  • Time-course Controls: Measurements at multiple time points

  • Temperature and pH Controls: Assays under different conditions to determine optima

For In vivo Studies:

  • Wild-type A. fulgidus as baseline control

  • Complementation Controls: AF_0761 mutant complemented with the wild-type gene

  • Environmental Controls: Consistent growth conditions between experiments

  • Reference Gene Controls: Stable reference genes for normalization in gene expression studies, such as AF0700, which showed no significant regulation in heat shock experiments

Incorporating these controls will help ensure that experimental results are robust, reproducible, and truly reflective of AF_0761's biological function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.