Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0762 (AF_0762)

What is known about the primary structure of AF_0762?

AF_0762 is a full-length protein consisting of 171 amino acid residues. The complete amino acid sequence is: MCLQIGGGGMDLRGQTFTLEGVAASLLILLAVYTIFQSTVVIAPSWSDYANVQLKQLGYDILRVFDSDGGNSSLKGAIVNCSSGFKAPDEFNANLSKILDSLNAFGKVELIWVNGSKIESHALYGFNKTPTPDAVRVSRFVVVQDLNNSECFNLTTPTTKVVEVRLTLWRT . This sequence information provides the foundation for further structural and functional analyses. Computational assessment of this sequence indicates potential transmembrane regions, particularly in the N-terminal half of the protein, suggesting it may be a membrane-associated protein. The presence of multiple glycine residues (GGGG) near the N-terminus might indicate a flexible region which could be important for protein function or interaction with other molecules.

How does AF_0762 fit into the genomic context of Archaeoglobus fulgidus?

AF_0762 is one of 2,436 open reading frames (ORFs) found in the 2,178,400 base pair genome of Archaeoglobus fulgidus . It belongs to the category of functionally uncharacterized yet conserved proteins that constitute approximately 25% of the A. fulgidus genome (651 ORFs) . This protein may be part of the two-thirds of uncharacterized proteins shared between A. fulgidus and Methanococcus jannaschii (approximately 428 ORFs), indicating conservation across archaeal species and suggesting an important, albeit currently unknown, functional role . The conservation implies evolutionary selection pressure to maintain this gene, highlighting its potential significance in archaeal biology.

What structural information is available for AF_0762 or related proteins?

While specific structural data for AF_0762 itself is limited in the provided sources, researchers can reference structural information from related uncharacterized proteins in Archaeoglobus fulgidus, such as the crystal structure available for protein O28723_ARCFU in the Protein Data Bank (PDB ID: 3BPD) . Though not identical to AF_0762, comparative structural analysis with related proteins can provide insights into potential structural features. For experimental structural determination, researchers should consider X-ray crystallography methods similar to those used for related proteins, utilizing software tools such as MOLREP for phasing, CNS for refinement, and MOSFLM for data reduction as documented for other A. fulgidus proteins .

What expression systems are optimal for recombinant production of AF_0762?

Based on successful production examples, E. coli remains the preferred heterologous expression system for recombinant AF_0762 . When designing expression constructs, researchers should consider the full-length protein (amino acids 1-171) with an N-terminal His-tag for purification purposes . This approach has yielded protein with greater than 90% purity as determined by SDS-PAGE . For expression optimization, factors to consider include: codon optimization for E. coli, induction temperature adjustment (potentially lower temperatures for membrane-associated proteins), and expression duration. If membrane association proves problematic, consider testing truncated constructs that exclude potential transmembrane domains or using specialized E. coli strains designed for membrane protein expression.

What purification strategies yield highest purity and stability for AF_0762?

A multi-step purification protocol is recommended, beginning with immobilized metal affinity chromatography (IMAC) utilizing the N-terminal His-tag . Subsequent purification steps may include size exclusion chromatography to remove aggregates and further improve purity. The final product should be formulated in a Tris-based buffer containing 50% glycerol for optimal stability during storage . For long-term storage, lyophilization may be considered, with the protein reconstituted to a concentration of 0.1-1.0 mg/mL in deionized sterile water . To maintain protein integrity, aliquoting is recommended to avoid repeated freeze-thaw cycles, with working aliquots stored at 4°C for up to one week and long-term storage at -20°C/-80°C .

How can researchers verify proper folding and functionality of recombinant AF_0762?

• Circular dichroism (CD) spectroscopy to assess secondary structure content

• Size exclusion chromatography to evaluate monodispersity

• Thermal shift assays to determine protein stability

• Limited proteolysis to identify stable domains and proper folding

What computational approaches can predict potential functions of AF_0762?

A multi-faceted computational analysis workflow is recommended:

Based on the genomic context of Archaeoglobus fulgidus, particular attention should be paid to potential roles in sulfur metabolism, as A. fulgidus is a sulfur-metabolizing organism with the notable distinction of being the first such organism to have its genome sequenced . The presence of clustered genes related to sulfate respiration in the A. fulgidus genome suggests potential involvement in this pathway . Comparative analysis with the 651 other functionally uncharacterized yet conserved proteins in A. fulgidus may reveal patterns of co-expression or co-evolution that provide functional clues .

What experimental approaches are most effective for determining the function of AF_0762?

A systematic experimental investigation should include:

• Protein-Protein Interaction Studies: Use pull-down assays with the His-tagged recombinant protein as bait to identify binding partners from A. fulgidus lysate. Alternatively, bacterial two-hybrid or yeast two-hybrid screening can identify potential interactors.

• Gene Knockout/Knockdown Analysis: While challenging in archaeal systems, CRISPR-Cas9 or similar gene editing techniques could be employed to observe phenotypic changes resulting from AF_0762 disruption.

• Localization Studies: Using fluorescently tagged versions of the protein expressed in A. fulgidus or related organisms to determine subcellular localization.

• Metabolomic Analysis: Compare metabolite profiles between wild-type and AF_0762-modified strains to identify metabolic pathways affected.

• Binding Assays: Screen for potential substrates, including sulfur compounds, given A. fulgidus' role in sulfur metabolism .

Since A. fulgidus operates in extreme environments as a hyperthermophilic archaeon, all experimental approaches must account for its unique physiological conditions, including high temperature and potential anaerobic requirements.

How might AF_0762 relate to sulfate respiration pathways in Archaeoglobus fulgidus?

While direct evidence linking AF_0762 to sulfate respiration is not provided in the search results, comparative genomics approaches suggest a potential connection. The clustered arrangement of genes involved in dissimilatory sulfate reduction observed in uncultured prokaryotes raises the possibility that AF_0762 could be part of such a functional cluster . To investigate this connection, researchers should:

• Analyze the genomic neighborhood of AF_0762 for proximity to known sulfate respiration genes

• Examine co-expression patterns with established components of sulfate respiration pathways

• Test for interactions with key proteins involved in electron transfer, such as the HmeACDE complex in A. fulgidus

• Assess structural similarities with components of the dissimilatory sulfate reduction pathway

The transmembrane characteristics suggested by the protein sequence could indicate involvement in electron transfer processes typical of respiratory chains, potentially connecting to the quinone-to-terminal acceptor electron transfer described in A. fulgidus .

What crystallization conditions have proven successful for similar A. fulgidus proteins?

Based on the crystallization of related uncharacterized proteins from A. fulgidus (such as PDB: 3BPD), researchers should consider the following crystallization parameters :

• Crystal System: Orthogonal crystal system with parameters:

  • Unit cell dimensions: a = 88.51 Å, b = 97.36 Å, c = 179.002 Å

  • Angles: α = 90°, β = 90°, γ = 90°

• Data Collection and Processing:

  • Data collection using MAR345 detector

  • Data reduction with MOSFLM

  • Data scaling with SCALA

• Phase Determination and Refinement:

  • Phasing using MOLREP

  • Structure refinement with CNS

Given the thermophilic nature of A. fulgidus, crystallization attempts at elevated temperatures (45-65°C) might promote proper folding and crystal formation. The presence of magnesium ions (Mg²⁺) has been documented in crystal structures of other A. fulgidus proteins, suggesting their potential importance for structural stability or function .

How can researchers effectively analyze potential ligand binding sites in AF_0762?

To identify and characterize potential ligand binding sites:

• Computational Prediction:

  • Use tools like CASTp, SiteMap, or FTSite to identify potential binding pockets

  • Molecular docking with candidate ligands based on predicted function

  • Molecular dynamics simulations to observe conformational changes

• Experimental Validation:

  • Thermal shift assays with potential ligands to identify stabilizing interactions

  • NMR-based ligand screening for binding confirmation

  • Co-crystallization with predicted ligands or substrate analogs

• Structure-Function Integration:

  • Map conserved residues onto the structural model to identify functionally important regions

  • Compare binding sites with structurally similar proteins of known function

  • Conduct site-directed mutagenesis of predicted binding site residues to confirm functional importance

The presence of magnesium ions in related protein structures may indicate potential metal binding sites that could be functionally relevant . Additionally, the presence of cysteine residues in the AF_0762 sequence suggests potential for metal coordination, possibly relating to the organism's sulfur metabolism.

How can AF_0762 contribute to our understanding of archaeal evolution and horizontal gene transfer?

Research on AF_0762 can provide insights into archaeal evolution through several approaches:

• Phylogenetic Analysis: Construct phylogenetic trees based on AF_0762 sequences across archaeal species and compare with 16S rRNA phylogeny to identify potential horizontal gene transfer (HGT) events.

• Comparative Genomics: Analyze the conservation and synteny of AF_0762 and surrounding genes across archaeal species. Evidence from other A. fulgidus genes suggests multiple independent events of HGT, particularly for genes involved in sulfate reduction pathways .

• Sequence Signature Analysis: Identify DNA composition signatures (GC content, codon usage) that might indicate foreign origin.

• Functional Context: If functional characterization establishes a role in sulfate metabolism, AF_0762 could contribute to understanding how A. fulgidus acquired its unique metabolic capabilities through potential gene transfer from bacterial sources. Studies on dissimilatory sulfite reductase (DsrAB) and adenosine-5′-phosphosulfate reductase (AprAB) in A. fulgidus have already suggested bacterial origins through HGT .

This research contributes to the broader understanding of prokaryotic evolution and the acquisition of metabolic capabilities through gene transfer events.

What insights might AF_0762 provide into extremophile protein adaptations?

As a protein from the hyperthermophilic archaeon A. fulgidus, AF_0762 offers valuable insights into molecular adaptations to extreme environments:

• Thermostability Analysis: Compare the amino acid composition of AF_0762 with mesophilic homologs to identify thermostability-conferring features such as increased charged residues, stronger hydrophobic core, or additional disulfide bonds.

• Structural Flexibility Studies: Analyze regions of structural rigidity versus flexibility at high temperatures using molecular dynamics simulations.

• Solvent Accessibility Patterns: Map the distribution of hydrophobic and hydrophilic residues to understand adaptation to high-temperature environments.

• Post-translational Modifications: Investigate unique modifications that might contribute to stability, such as the selenomethionine residues (MSE) observed in related A. fulgidus proteins .

These studies can reveal generalizable principles of protein adaptation to extreme environments, potentially applicable to protein engineering for industrial applications requiring thermostable enzymes.

What are common challenges in working with recombinant AF_0762 and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant AF_0762:

For storage and handling specifically, the recombinant protein should be maintained in Tris-based buffer with 50% glycerol . For reconstitution of lyophilized protein, deionized sterile water should be used to reach a concentration of 0.1-1.0 mg/mL . Working aliquots can be stored at 4°C for up to one week, while long-term storage requires -20°C/-80°C conditions .

How can researchers effectively integrate computational and experimental approaches for AF_0762 characterization?

An integrated research pipeline for AF_0762 characterization should follow this sequence:

• Initial Computational Analysis:

  • Sequence-based predictions (homology, domains, structure)

  • Genomic context analysis

  • Generation of testable hypotheses

• Preliminary Experimental Validation:

  • Expression and purification optimization

  • Basic biochemical characterization (oligomeric state, stability)

  • Structural studies (crystallography, cryo-EM)

• Hypothesis-Driven Functional Testing:

  • Targeted interaction studies based on computational predictions

  • Site-directed mutagenesis of predicted functional residues

  • Specific activity assays guided by computational insights

• Iterative Refinement:

  • Update computational models based on experimental results

  • Design next-generation experiments based on refined hypotheses

  • Expand to system-level analysis (metabolomics, transcriptomics)

This iterative approach maximizes research efficiency by using computational predictions to guide experimental design, while experimental results inform refinement of computational models.