Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0763 (AF_0763)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0763 (AF_0763) is a protein derived from the archaeon Archaeoglobus fulgidus. A. fulgidus is a hyperthermophilic archaeon known for its ability to reduce sulfate at high temperatures . AF_0763 is referred to as an uncharacterized protein, which means its specific function within A. fulgidus is not yet well-defined through experimental studies .

Basic Characteristics

CharacteristicDescription
Source OrganismArchaeoglobus fulgidus
TypeUncharacterized protein
Expression SystemOften expressed in E. coli as a recombinant protein for research purposes
TagCommonly fused to a His-tag to facilitate purification

Recombinant Production

Recombinant AF_0763 is typically produced in Escherichia coli (E. coli) using recombinant DNA technology . The gene encoding AF_0763 is inserted into a plasmid vector and transformed into E. coli cells. The E. coli then expresses the protein, which can be purified using affinity chromatography, often by utilizing a His-tag fused to the protein .

Related Research

  • AF1382 Structure Determination: The crystal structure of another orphan ORF from A. fulgidus, AF1382, has been determined using sulfur SAD phasing . AF1382 shows a winged-helix-turn-helix structure, similar to DNA-binding proteins .

  • D-Lactate Dehydrogenase: A. fulgidus can utilize D-lactate, and its D-lactate dehydrogenase (Dld) has been cloned and expressed in E. coli . The recombinant Dld (rDld) is specific for D-lactate and requires the flavin cofactor FAD for activity .

  • CO Utilization: A. fulgidus can use CO as a growth substrate, coupling CO oxidation to sulfate reduction . It incorporates CO as the carboxyl moiety and CO$$_2$$ as the methyl moiety of acetate .

  • AF_1524 recombinant protein: Recombinant Full Length Archaeoglobus fulgidus Uncharacterized protein Af_1524 (Af_1524) Protein, His-Tagged, was expressed in E. coli .

Potential Functions

  • Stress Response: Similar to how diglycerol phosphate accumulates under salt stress in A. fulgidus, AF_0763 might play a role in responding to environmental stressors .

  • Metabolic Processes: Given that A. fulgidus is involved in sulfate reduction and can utilize compounds like CO and D-lactate, AF_0763 could be involved in these or other metabolic pathways .

  • DNA Binding: Like AF1382, AF_0763 could potentially have a DNA-binding function, influencing gene regulation .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
AF_0763; Uncharacterized protein AF_0763
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0763
Target Protein Sequence
MDNQAKLSLDLLLGLSIFLTTFLFVANFLPGIFADVRHEIALGSHAYRVAALLVEDPGYP DDWCTAVDTSNCISKEFRPGLAIFDENNGTEYNYLNTSKIFKLQELLSNSACRDTVRNYL GLNSTNFKYKFYFSLKYLNDTEIVSGGDNLPEMGNIIKFDRLVYVDNCTAIPCESIAERC VCKLEVAVWI
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0763

STRING: 224325.AF0763

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about Archaeoglobus fulgidus proteins in general?

Archaeoglobus fulgidus is a hyperthermophilic archaeon with numerous proteins adapted to extreme conditions. Research on this organism has revealed proteins with unique structural and functional properties, including the well-characterized Argonaute protein (AfAgo), which functions as a homodimer capable of simultaneously interacting with two DNA molecules . Many proteins from this organism remain uncharacterized, including AF_0763, presenting opportunities for novel discoveries in protein structure and function. Methodologically, researchers approach uncharacterized proteins by first examining sequence homology, predicting domains, and then conducting expression trials under conditions that account for the hyperthermophilic origin of the organism.

Why is studying uncharacterized proteins from extremophiles valuable?

Studying uncharacterized proteins from extremophiles like A. fulgidus provides insights into protein adaptation to extreme environments and often reveals novel biochemical mechanisms. For example, research on AfAgo has broadened our understanding of Argonaute-nucleic acid interaction mechanisms beyond what was previously known from eukaryotic models . Methodologically, researchers should approach uncharacterized extremophile proteins with techniques that preserve their native properties, such as thermostability assays and activity testing across wide temperature and pH ranges.

What are the predicted structural features of AF_0763?

While specific information about AF_0763 is limited, structure prediction should begin with sequence analysis using tools like Phyre2, I-TASSER, and AlphaFold2. Based on approaches used for other A. fulgidus proteins, researchers should examine for conserved domains and motifs, particularly those common in archaeal proteins. For proteins like AfAgo, structural analysis revealed distinct domains (MID and PIWI) that were critical for understanding function . Methodologically, researchers should compare predicted structures with characterized proteins from the same organism, such as AfAgo, to identify potential structural similarities that might suggest functional relationships.

What expression systems are appropriate for recombinant AF_0763?

Based on experience with other archaeal proteins, E. coli expression systems with heat-shock promoters are typically used for initial trials. For AfAgo, successful expression was achieved using the pETDuet vector in E. coli strain BL21(DE3) with induction at lowered temperatures (16°C) to enhance proper folding . Methodologically, researchers should test multiple expression constructs with various tags (His, MBP, SUMO) and expression conditions (temperature, induction duration) to optimize yield and solubility.

How can I verify the purity and identity of recombinant AF_0763?

Verification should employ multiple complementary techniques. SDS-PAGE analysis and size exclusion chromatography can assess purity, while mass spectrometry can confirm protein identity. Western blotting with anti-His antibodies can verify tag presence for His-tagged constructs. Additionally, researchers should consider N-terminal sequencing to confirm the protein sequence matches the expected AF_0763 sequence. For archaeal proteins like AfAgo, researchers have used techniques such as SEC-MALS to determine oligomeric state, which proved critical for understanding its function .

How should AF_0763 oligomerization state be characterized?

Based on findings with AfAgo, which unexpectedly functions as a homodimer , researchers should not assume monomeric states for uncharacterized archaeal proteins. Methodologically, use multiple complementary techniques:

For AfAgo, SEC-MALS and SAXS were particularly valuable in confirming dimerization in solution, revealing a compact "closed" dimer form that was the predominant state .

What approaches should I use to investigate potential nucleic acid binding by AF_0763?

Given that A. fulgidus proteins like AfAgo interact with nucleic acids in unexpected ways, AF_0763 should be tested with various nucleic acid types. Methodologically, employ:

  • Electrophoretic mobility shift assays (EMSAs) with both DNA and RNA substrates of varying lengths and structures

  • Fluorescence anisotropy to measure binding affinities

  • Single-molecule FRET to detect potential changes in nucleic acid conformation upon binding

  • Atomic force microscopy (AFM) to visualize protein-nucleic acid complexes

For AfAgo, these techniques revealed unexpected DNA looping activities through simultaneous binding at two distant sites . AFM was particularly valuable, showing that 51% of AfAgo-DNA complexes formed ring-shaped structures, indicating simultaneous binding to both DNA ends .

How can I investigate potential enzymatic activities of AF_0763?

Without prior knowledge of function, test for common archaeal enzyme activities using high-throughput screening approaches. Methodologically:

  • Test for nuclease activity using labeled DNA/RNA substrates

  • Assess potential ATPase/GTPase activity with colorimetric phosphate release assays

  • Investigate redox activities using appropriate electron donors/acceptors

  • Screen for thermostable enzymatic functions relevant to extreme environments

Remember that even if AF_0763 lacks catalytic activity (like AfAgo's inactive PIWI domain ), it may still have important biological functions through protein-protein or protein-nucleic acid interactions.

What temperature conditions should be used for AF_0763 functional assays?

Given A. fulgidus is hyperthermophilic with an optimal growth temperature around 83°C, functional assays should span a wide temperature range. Methodologically:

  • Start with a temperature gradient (37-95°C) to determine optimal activity

  • For thermostability analysis, use differential scanning fluorimetry (DSF) to measure melting temperature

  • Consider salt concentration effects, as hyperthermophilic proteins often require high salt for stability

  • Include appropriate controls with known thermostable and mesophilic proteins

The table below outlines a suggested temperature testing protocol:

Temperature (°C)Buffer ConditionsExpected ObservationsControls
37Standard + 300mM NaClBaseline activityE. coli protein
60Standard + 300mM NaClIncreased activityThermostable protein
75Standard + 500mM NaClNear optimal activityAfAgo protein
85Standard + 500mM NaClOptimal activityNative A. fulgidus extract
95Standard + 500mM NaClPotential denaturationNone

How should I address solubility issues with recombinant AF_0763?

Archaeal proteins often present solubility challenges in heterologous expression systems. Methodologically:

  • Test multiple solubilizing tags (MBP, SUMO, GST) and compare yields

  • Optimize lysis buffers with varying salt concentrations (300-500mM)

  • Include stabilizing agents (10% glycerol, 1mM DTT)

  • Consider on-column refolding if inclusion bodies form

  • Test expression at lower temperatures (16-20°C) with longer induction times

For AfAgo, expression at 16°C after IPTG induction proved effective for obtaining soluble protein . Archaeal proteins often benefit from mimicking their native high-salt environment during purification.

How can I distinguish between specific and non-specific nucleic acid interactions?

Distinguishing specific from non-specific interactions requires methodical analysis. Based on techniques used for AfAgo :

  • Compare binding affinities across different nucleic acid sequences

  • Use competition assays with specific and non-specific competitors

  • Perform salt titrations (specific interactions often resist higher salt)

  • Analyze binding stoichiometry using techniques like ITC or SEC-MALS

  • Create binding site mutations to verify specificity determinants

For AfAgo, researchers used single-molecule FRET to quantify DNA looping efficiency, demonstrating specific binding to DNA ends . This approach revealed that the wild-type protein exhibited significantly higher DNA looping (35.1%) compared to the dimerization-impaired mutant (20.8%) .

How should apparent contradictions in AF_0763 functional data be approached?

When facing contradictory results, implement a systematic resolution approach:

  • Critically review experimental conditions for variables that might explain differences

  • Consider protein batch variations, storage conditions, and buffer compositions

  • Test for potential contaminants that might contribute activity

  • Design experiments specifically to test competing hypotheses

  • Consider that AF_0763 might have multiple activities or conformational states

In the case of AfAgo, researchers observed two different dimer configurations ("open" and "closed") in crystal structures, creating apparent contradictions. Through SAXS analysis, they determined that the "closed" dimer was predominant in solution, reconciling these observations .

What techniques are most informative for determining AF_0763 function in vivo?

Understanding AF_0763's biological role requires multiple approaches:

  • Gene knockout or silencing in A. fulgidus (if genetic tools are available)

  • Proteomics to identify interaction partners

  • RNA-seq to detect expression patterns under different conditions

  • ChIP-seq or similar techniques if DNA binding is suspected

  • Heterologous expression in model organisms to test for phenotypic effects

For AfAgo, researchers hypothesized potential roles in host defense against invading nucleic acids based on its DNA binding properties, despite lacking nuclease activity. They drew parallels to catalytically inactive pAgos that may function with host nucleases .

How can structural dynamics of AF_0763 be investigated?

To understand potential conformational changes during function:

  • Employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with differential solvent exposure

  • Use FRET pairs at strategic positions to monitor distance changes

  • Consider single-molecule techniques to detect conformational heterogeneity

  • For thermostable proteins, conduct experiments at elevated temperatures to capture physiologically relevant dynamics

For AfAgo, researchers used SAXS and single-molecule FRET to investigate the dynamics of DNA binding and looping . Total internal reflection fluorescence (TIRF) microscopy was particularly valuable for observing the dynamics of DNA looping events in real-time .

What are the implications of AF_0763 characterization for understanding archaeal biology?

Characterizing AF_0763 could provide insights into archaeal-specific biological processes and potentially reveal novel molecular mechanisms. AfAgo's characterization revealed an unexpected homodimerization mechanism not previously observed in Argonaute proteins, broadening understanding of nucleic acid processing mechanisms . Similarly, AF_0763 characterization may uncover unique features adapted to extreme environments that could inform both basic biology and biotechnological applications.

How might findings from AF_0763 research inform studies of related proteins in other organisms?

Discoveries from uncharacterized archaeal proteins often have broader implications. Methodologically, researchers should:

  • Conduct thorough phylogenetic analyses to identify homologs

  • Test whether identified mechanisms are conserved in homologs

  • Consider how extreme environment adaptations might be modified in mesophilic organisms

  • Explore potential biotechnological applications based on unique properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.