Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0836 (AF_0836)

Shipped with Ice Packs
In Stock

Description

Gene Information

AttributeValue
Gene NameAF_0836
SynonymsAF_0836; Uncharacterized protein
UniProt IDO29422
OrganismArchaeoglobus fulgidus (strain VC-16/DSM 4304)
Amino Acid Sequence
MEKIKKFLIQLLNMRARNTVDIIASIVGAVIIAAAISALLFSIASFLGFYSKDLSPLVYS IVSLAVIPVLRRNVPKKPILSLLTAFSIPILFLSGVEWLKLVASVLLGYLAASSLKDS

Expression and Purification

ParameterDetail
Expression HostE. coli
TagN-terminal His-tag
Protein LengthFull-length (1–118 amino acids)
Purity>90% (SDS-PAGE)
FormLyophilized powder

Key Features

  • Stability: Resists denaturation under high-temperature conditions due to its hyperthermophilic origin.

  • Functional Partners: No documented interactions or pathways identified to date .

Functional Characteristics

AttributeDetail
Catalytic ActivityNot characterized
Substrate SpecificityUnknown
Co-factorsNone reported

Thermal Stability

  • Optimal Activity: No data available.

  • Storage Recommendations:

    • Short-term: 4°C for ≤1 week (working aliquots).

    • Long-term: -20°C/-80°C with 50% glycerol to prevent freeze-thaw cycles .

Experimental Uses

ApplicationDetails
Structural StudiesCrystallization, X-ray/NMR analysis
Functional AssaysEnzyme activity screening, substrate identification
Antibody ProductionELISA-based detection (e.g., CSB-CF519870DOC kit)

Reconstitution Guidelines

  1. Buffer: Tris/PBS-based buffer (pH 8.0) with 6% trehalose .

  2. Concentration: 0.1–1.0 mg/mL in sterile water.

  3. Glycerol Addition: 5–50% final concentration recommended for stability .

Critical Notes

  • Freeze-Thaw Cycles: Strictly avoid repeated cycles to prevent aggregation.

  • Compatibility: Compatible with glycerol but incompatible with reducing agents (e.g., DTT) .

Research Gaps and Future Directions

AF_0836 remains poorly characterized, with no functional annotations in public databases (e.g., UniProt, KEGG). Key areas for investigation include:

  1. Catalytic Function: Identification of substrates or redox partners.

  2. Structural Role: Potential involvement in stress response or metabolic pathways.

  3. Comparative Genomics: Homology analysis with archaeal proteins from related genera (e.g., Ferroglobus, Geoglobus) .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_0836; Uncharacterized protein AF_0836
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0836
Target Protein Sequence
MEKIKKFLIQLLNMRARNTVDIIASIVGAVIIAAAISALLFSIASFLGFYSKDLSPLVYS IVSLAVIPVLRRNVPKKPILSLLTAFSIPILFLSGVEWLKLVASVLLGYLAASSLKDS
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0836

STRING: 224325.AF0836

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant for protein research?

Archaeoglobus fulgidus is a hyperthermophilic, sulphate-reducing archaeon that thrives in extreme environments with optimal growth temperatures around 83°C. This organism represents one of the most extensively studied model extremophiles, with proteins that demonstrate exceptional thermostability and unique structural properties . Proteins from A. fulgidus, including AF_0836, provide valuable insights into molecular adaptations to extreme conditions, protein evolution mechanisms, and novel enzymatic functions. From a structural biology perspective, proteins from hyperthermophiles often crystallize more readily than their mesophilic counterparts, making them excellent candidates for detailed structural studies and comparative analyses.

What is currently known about the function of the uncharacterized protein AF_0836?

AF_0836 is classified as an uncharacterized protein from Archaeoglobus fulgidus with a sequence length of 118 amino acids . While its specific biological function remains undetermined, recombinant versions have been successfully expressed with His-tags, facilitating purification and experimental characterization . The protein is available as a full-length recombinant protein expressed in E. coli systems, suggesting successful heterologous expression is possible . Without confirmed functional data, researchers typically approach uncharacterized proteins through comparative genomics, structural prediction, and systematic biochemical assays to identify potential enzymatic activities or binding partners.

What expression systems are most suitable for recombinant AF_0836 production?

Based on available information, E. coli has been successfully employed as an expression host for recombinant AF_0836 production . For archaeal proteins, several expression systems can be considered:

Expression SystemAdvantagesLimitationsConsiderations for AF_0836
E. coliHigh yield, well-established protocols, economicalPotential folding issues with archaeal proteinsUse low-temperature induction (15-30°C); consider codon optimization
Yeast systemsBetter for complex proteins, some post-translational modificationsLower yield than E. coliSuitable if E. coli expression results in misfolding
Cell-free systemsAvoids toxicity issues, rapid expressionLimited scale, expensiveUseful for initial functional screening
Archaeal hostsNative environment, proper foldingTechnically challengingConsider for native structural studies
The documented successful expression in E. coli suggests this system is viable for AF_0836, though optimization of expression conditions may be necessary to maximize yield and proper folding .

How can researchers verify the identity and purity of recombinant AF_0836?

Verification of recombinant AF_0836 should follow a systematic characterization protocol:

  • SDS-PAGE analysis to confirm molecular weight (expected ~13 kDa plus tag size)

  • Western blot using anti-His antibodies for tagged versions

  • Mass spectrometry for precise mass determination and potential post-translational modifications

  • N-terminal sequencing to confirm protein identity

  • Size exclusion chromatography to assess oligomeric state and homogeneity

  • Circular dichroism to evaluate secondary structure content
    For archaeal proteins, researchers can leverage thermostability as a purification advantage. Heat treatment (e.g., 70-80°C for 15-30 minutes) may denature contaminating E. coli proteins while leaving the thermostable archaeal protein intact . This approach has been successfully applied to other A. fulgidus proteins and can significantly enhance purity when combined with affinity chromatography using the His-tag .

What structural characteristics might distinguish AF_0836 from other proteins?

While specific structural information for AF_0836 is limited, proteins from hyperthermophiles like A. fulgidus typically exhibit distinctive structural features contributing to their thermostability:

Structural FeatureContribution to ThermostabilityDetection Method
Increased salt bridgesEnhanced electrostatic interactionsX-ray crystallography, homology modeling
Higher proportion of charged residuesContribute to ionic networksSequence analysis, isoelectric focusing
Compact hydrophobic coreMinimizes solvent-exposed hydrophobic regionsStructural analysis, fluorescence spectroscopy
Shorter surface loopsReduced flexibility of potentially unstable regionsStructure comparison with mesophilic homologs
Increased proline contentRestricted backbone conformational freedomSequence analysis
Disulfide bondsAdditional stabilization of tertiary structureStructural analysis, thiol reactivity assays
The structural characterization of other uncharacterized proteins from A. fulgidus has revealed unique fold characteristics, as seen in the crystal structure of O28723_ARCFU (AF_1549) . Similar structural studies would be valuable for elucidating the specific features of AF_0836.

How does temperature affect the stability and activity of recombinant AF_0836?

Given that A. fulgidus is a hyperthermophile with an optimal growth temperature around 83°C, AF_0836 likely exhibits significant thermostability that should be systematically characterized:

  • Thermal denaturation studies: Using differential scanning calorimetry (DSC) or thermal shift assays to determine melting temperature (Tm), which is likely to be significantly above 80°C based on other A. fulgidus proteins .

  • Activity measurements: Once function is established, activity assays at different temperatures (20-100°C) to determine temperature optimum and activation energy.

  • Long-term stability tests: Evaluating structural integrity and activity retention after prolonged incubation at various temperatures.

  • Comparative analysis: Comparing stability parameters with mesophilic homologs to identify thermostabilizing features.
    Research with other A. fulgidus proteins has demonstrated that these hyperthermophilic proteins often maintain structural integrity even after multiple freeze-thaw cycles and exhibit resistance to chemical denaturants and proteolytic degradation , properties that would be valuable to confirm for AF_0836.

What methodologies are recommended for functional characterization of AF_0836?

For uncharacterized proteins like AF_0836, a systematic approach to functional characterization should include:

  • Bioinformatic analysis:

    • Sequence similarity searches against characterized proteins

    • Domain and motif identification

    • Structural prediction and comparison

    • Genomic context analysis to identify potential functional relationships

  • Structural studies:

    • X-ray crystallography or NMR spectroscopy to determine 3D structure

    • Identification of potential active sites or binding pockets

    • Comparison with structural databases

  • Biochemical screening:

    • Activity assays for common enzymatic functions

    • Substrate screening panels

    • Cofactor requirements assessment

  • Interaction studies:

    • Pull-down assays to identify binding partners

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Co-immunoprecipitation with A. fulgidus cell lysate

  • In vivo studies:

    • Expression analysis under different growth conditions

    • Localization studies if antibodies are available

    • Phenotypic analysis of knockout or overexpression strains if genetic tools exist
      The search results indicate that AF_0836 may have direct interactions with other proteins and molecules, suggesting interaction studies could be particularly informative .

How can researchers investigate potential interactions between AF_0836 and other proteins?

Given that AF_0836 has direct interactions with proteins and molecules , several complementary approaches can be employed:

MethodApplicationConsiderations for AF_0836
Pull-down assaysIdentify direct binding partnersUtilize His-tag for immobilization; perform at physiologically relevant temperatures
Thermal shift assaysDetect stabilization upon ligand bindingMay require high temperatures due to intrinsic thermostability
Surface plasmon resonanceQuantify binding kineticsEnsure buffer stability at elevated temperatures
Isothermal titration calorimetryDetermine thermodynamic parametersParticularly suitable for thermophilic proteins
Cross-linking mass spectrometryMap interaction interfacesUse thermostable cross-linking reagents
Co-crystallizationStructural characterization of complexesConsider stabilizing conditions for complex formation
For AF_0836, special consideration should be given to performing interaction studies under conditions that mimic its native environment (high temperature, specific pH, salt concentration). Additionally, potential interaction partners should be selected based on genomic context, co-expression data, or knowledge of A. fulgidus biology.

What challenges might arise when studying recombinant AF_0836 and how can they be addressed?

Studying recombinant proteins from hyperthermophiles presents several unique challenges:

  • Expression and folding issues:

    • Challenge: Improper folding in mesophilic expression hosts

    • Solution: Optimize expression temperature (15-30°C), use specialized E. coli strains, consider archaeal expression systems

  • Experimental conditions:

    • Challenge: Standard laboratory equipment and reagents may not function at optimal temperatures for AF_0836

    • Solution: Use temperature-stable equipment, modify protocols for high-temperature assays, ensure buffer stability

  • Functional assessment:

    • Challenge: Unknown function makes assay development difficult

    • Solution: Employ systematic screening approaches, leverage structural information, use comparative genomics

  • Stability considerations:

    • Challenge: Potential conformational differences at mesophilic versus thermophilic temperatures

    • Solution: Perform comparative analyses at multiple temperatures, include controls at physiologically relevant conditions
      The immunodepletion approach used with other A. fulgidus proteins could be adapted to study AF_0836, potentially helping to determine its relative abundance and importance in cellular functions.

What are the optimal buffer conditions for maintaining AF_0836 stability?

Without specific data on AF_0836, we can provide general recommendations for archaeal thermostable proteins based on studies of other A. fulgidus proteins:

Buffer ComponentRecommended RangeRationale
pH6.0-8.0Many archaeal proteins have optimal stability in slightly acidic to neutral pH
Salt (NaCl)100-500 mMHigher salt concentrations often stabilize thermophilic proteins
Divalent cations1-10 mM MgCl₂Many archaeal proteins require divalent cations for stability
Reducing agents1-5 mM DTT or β-mercaptoethanolPrevents oxidation of cysteine residues
Stabilizing agents5-10% glycerolPrevents aggregation and improves freeze-thaw stability
Protease inhibitorsPMSF, EDTA, or commercial cocktailsPrevents degradation during storage
The crystal structure of another A. fulgidus uncharacterized protein shows magnesium ion binding , suggesting divalent cations may be important for structural integrity of proteins from this organism. Researchers should systematically test buffer conditions through thermal shift assays or activity retention studies to optimize stability for AF_0836.

What techniques can be used to study the thermostability of AF_0836?

Several biophysical techniques are particularly useful for characterizing the thermostability of proteins from hyperthermophiles:

  • Differential scanning calorimetry (DSC):

    • Directly measures the heat capacity of protein solutions as a function of temperature

    • Provides thermodynamic parameters (ΔH, ΔS, ΔG) of protein unfolding

    • Can detect multiple transitions in multi-domain proteins

  • Circular dichroism (CD) spectroscopy:

    • Monitors changes in secondary structure during thermal denaturation

    • Enables determination of melting temperatures (Tm)

    • Requires relatively small amounts of protein

  • Fluorescence-based thermal shift assays:

    • Uses environment-sensitive dyes (e.g., SYPRO Orange) that bind to exposed hydrophobic regions

    • Suitable for high-throughput screening of stabilizing conditions

    • Might require optimization for proteins with very high Tm values

  • Activity-based approaches:

    • Once function is determined, measure activity retention after heat treatment

    • Provides functional relevance to thermostability measurements

    • Has been successfully used with other A. fulgidus proteins
      For AF_0836, researchers should consider using specialized equipment capable of measurements at elevated temperatures (up to 100°C) to capture the full stability profile of this thermophilic protein.

How should researchers approach structure-function studies for AF_0836?

For an uncharacterized protein like AF_0836, a systematic structure-function analysis would involve:

  • Structural determination:

    • X-ray crystallography or NMR spectroscopy to determine 3D structure

    • Computational analysis to identify potential active sites or binding pockets

    • Comparison with structural databases to identify similar folds

  • Sequence analysis and conservation:

    • Multiple sequence alignment with homologs

    • Identification of conserved residues that might be functionally important

    • Evolutionary analysis to identify co-evolving residues

  • Site-directed mutagenesis:

    • Target conserved residues in potential active sites

    • Generate alanine-scanning mutants to identify essential residues

    • Test specific hypotheses about structure-function relationships

  • Domain analysis:

    • Express individual domains if present

    • Examine interdomain interactions and their contribution to function

    • Create chimeric proteins with domains from related proteins

  • Functional characterization:

    • Develop activity assays based on structural insights

    • Test substrate specificity and reaction conditions

    • Identify cofactor requirements and binding partners
      Similar approaches have been successfully applied to other A. fulgidus proteins, such as the family 4 uracil-DNA glycosylase, where expression, purification, and functional characterization revealed its role in DNA repair mechanisms .

What considerations should be made when designing experiments with AF_0836 in extremophilic conditions?

When working with proteins from extremophiles like A. fulgidus, experimental design must account for their unique properties:

  • Temperature considerations:

    • Ensure equipment can maintain stable high temperatures

    • Verify thermal stability of all reagents and buffers

    • Consider temperature gradients and heating/cooling rates

  • Anaerobic conditions:

    • A. fulgidus is a sulphate-reducing anaerobe, so oxygen sensitivity might be relevant

    • Use oxygen-scavenging systems or anaerobic chambers when appropriate

    • Include reducing agents in buffers

  • Buffer stability:

    • Verify pH stability of buffers at high temperatures

    • Account for changes in pKa values with temperature

    • Consider using buffers with minimal temperature dependence

  • Enzyme kinetics:

    • Reaction rates typically increase with temperature (Arrhenius relationship)

    • Substrate and product stability may become limiting at high temperatures

    • Standard assay components may degrade rapidly at extreme conditions

  • Control experiments:

    • Include mesophilic homologs as controls when possible

    • Perform parallel experiments at standard and extremophilic conditions

    • Consider time-dependent effects during extended high-temperature incubations
      The approaches used for characterizing the base excision repair pathway in A. fulgidus provide valuable methodological insights that could be adapted for studies of AF_0836, particularly regarding the maintenance of appropriate experimental conditions that reflect the native environment of this extremophilic organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.