Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1016 (AF_1016)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements; we will prioritize their implementation.
Synonyms
AF_1016; Uncharacterized protein AF_1016
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1016
Target Protein Sequence
MGGIMDARRLEDEVEMPLEGIVYGEVSGWLTIIGILVAIAGIIIGVVTGNSVFDYQSTIK DLLSGHDEEKIWTDDSIFHSEPHGYWFLNVIHTGDGIAMFGIALAVYGGIVGLLLLIVFT FRSREVLLYKKGLYTFLAIAIFCLMVYCAWEAEF
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1016

STRING: 224325.AF1016

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does AF_1016 compare to other proteins in Archaeoglobus fulgidus?

While specific comparative data for AF_1016 is limited in the search results, we can place it in context of the A. fulgidus proteome. The A. fulgidus genome contains approximately 2,410 open reading frames (ORFs) . Unlike well-characterized proteins such as the heat shock proteins (HSPs) encoded by AF1296 (hsp20-1) and AF1971 (hsp20-2), or regulatory proteins like HSR1 (AF1298), AF_1016 has not been identified as part of specific regulatory networks or stress responses based on the available literature .

Unlike the differentially expressed genes observed during heat shock response studies (approximately 350 genes, or 14% of the genome), AF_1016 was not identified among the significantly heat-regulated genes in the microarray studies of A. fulgidus .

What are the optimal storage and reconstitution conditions for recombinant AF_1016?

For optimal storage and reconstitution of recombinant AF_1016, researchers should follow these evidence-based protocols:

Storage Protocol:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • Make working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%)

  • Aliquot for long-term storage at -20°C to -80°C

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during the lyophilization process .

What expression systems are most effective for producing recombinant AF_1016?

The most validated expression system for recombinant AF_1016 production is E. coli. The commercially available recombinant protein is produced using an E. coli expression system with an N-terminal His-tag for purification purposes .

When designing your own expression experiments, consider the following methodological approach:

  • Vector Design: Include the full coding sequence (1-154 amino acids) with an N-terminal His-tag for affinity purification

  • Host Selection: E. coli strains optimized for recombinant protein expression (e.g., BL21(DE3)) are recommended

  • Induction Parameters: While specific induction conditions aren't detailed in the search results, typical IPTG induction protocols for archaeal proteins often utilize lower temperatures (16-30°C) to improve solubility

  • Purification Strategy: Immobilized metal affinity chromatography (IMAC) using the His-tag, followed by additional chromatography steps to achieve >90% purity

What purification methods yield the highest purity AF_1016 preparations?

To achieve high-purity preparations of recombinant AF_1016 (>90% as determined by SDS-PAGE), researchers should implement a multi-step purification strategy:

  • Initial Capture: Utilize the N-terminal His-tag with nickel or cobalt-based IMAC (Immobilized Metal Affinity Chromatography)

  • Intermediate Purification: Consider ion exchange chromatography based on the theoretical pI of the protein

  • Polishing Step: Size exclusion chromatography to remove aggregates and achieve final purity

  • Quality Control: Validate purity using SDS-PAGE and consider Western blotting with anti-His antibodies to confirm identity

For applications requiring ultra-high purity, additional techniques such as hydrophobic interaction chromatography might be considered, particularly given the hydrophobic nature suggested by the amino acid sequence.

How can structural studies of AF_1016 be optimized given its potential membrane association?

Based on the amino acid sequence analysis of AF_1016, which contains several hydrophobic regions suggestive of potential membrane association, researchers should consider specialized approaches for structural studies:

  • X-ray Crystallography Optimization:

    • Utilize detergent screening to identify optimal solubilization conditions

    • Consider lipidic cubic phase (LCP) crystallization methods

    • Implement surface entropy reduction mutations to improve crystal packing

    • Test fusion proteins (e.g., T4 lysozyme insertion) to increase soluble domains

  • NMR Spectroscopy Approaches:

    • Implement selective isotopic labeling strategies

    • Consider solid-state NMR for membrane-embedded regions

    • Use detergent micelles or nanodiscs to mimic the native membrane environment

  • Cryo-EM Considerations:

    • Utilize amphipols or nanodiscs for single-particle analysis

    • Consider 2D crystallization approaches for membrane proteins

While AF_1016's specific structural properties haven't been reported in the literature, these approaches represent standard methodologies for similar archaeal membrane-associated proteins.

What experimental approaches could help elucidate the function of AF_1016?

Given the uncharacterized nature of AF_1016, a systematic experimental workflow would be valuable for functional characterization:

  • Comparative Genomics:

    • Identify homologs in other archaeal species

    • Look for conserved domains or motifs

    • Analyze genomic context for potential functional associations

  • Expression Analysis:

    • Perform RNA-seq under various growth conditions

    • Compare with existing microarray data from heat shock experiments

    • Determine if AF_1016 expression correlates with specific stress responses

  • Protein Interaction Studies:

    • Conduct pull-down assays using the His-tagged protein

    • Perform yeast two-hybrid or bacterial two-hybrid screening

    • Consider proximity labeling approaches (BioID, APEX) for in vivo interaction mapping

  • Knockout/Knockdown Studies:

    • Generate genetic deletion or CRISPR interference systems

    • Perform phenotypic characterization under various conditions

    • Conduct comparative proteomics/metabolomics on mutant strains

  • Biochemical Activity Screening:

    • Test for enzymatic activities based on structural predictions

    • Assess membrane transport capabilities if predicted to be a transporter

    • Examine DNA/RNA binding capacity if regulatory functions are suspected

This systematic approach can provide multiple lines of evidence to establish functional hypotheses for this uncharacterized protein.

How might AF_1016 relate to the heat shock response in Archaeoglobus fulgidus?

While AF_1016 was not specifically identified among the heat shock-responsive genes in the comprehensive microarray study of A. fulgidus , researchers investigating potential relationships should consider:

  • Re-examination with Higher Sensitivity:

    • Perform RT-qPCR with primers specific to AF_1016 under heat shock conditions

    • Use more sensitive RNA-seq approaches that might detect lower-level changes

    • Consider different time points than those used in the original study (5-60 min)

  • Protein-Level Changes:

    • Examine AF_1016 protein abundance changes during heat shock using targeted proteomics

    • Investigate post-translational modifications that might occur without transcriptional changes

    • Assess protein localization changes during stress

  • Interaction with Known Heat Shock Components:

    • Test for physical interactions with the HSR1 regulator (AF1298)

    • Examine potential interactions with known heat shock proteins like Hsp20 (AF1296)

    • Investigate binding to the conserved heat shock regulatory motif CTAAC-N5-GTTAG

Unlike the documented heat shock regulators such as HSR1, which shows autoregulation and participates in a heat shock-responsive operon with Hsp20 and cdc48 , AF_1016 has not been definitively linked to this response network based on current evidence.

How does AF_1016 compare to similar proteins in other archaeal species?

A systematic comparison of AF_1016 with proteins from other archaeal species would involve:

  • Sequence Homology Analysis:

    • Perform BLAST searches against archaeal genomes

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Identify conserved domains or motifs across homologs

  • Comparative Genomic Context:

    • Examine gene neighborhoods in related species

    • Identify syntenic regions that might suggest functional relationships

    • Compare with the genetic context of functionally characterized proteins in other archaea

  • Structural Prediction Comparison:

    • Generate structural models using homology modeling or AI-based prediction tools

    • Compare predicted structures with resolved structures of related proteins

    • Identify conserved structural features that might suggest function

While specific comparative data for AF_1016 is not provided in the search results, this approach represents a standard research methodology for comparative analysis of archaeal proteins.

What is known about the expression patterns of AF_1016 in different growth conditions?

Unlike some other A. fulgidus proteins that show differential expression under stress conditions, specific expression pattern data for AF_1016 across different growth conditions is not detailed in the search results.

Researchers interested in characterizing expression patterns should consider:

  • Growth Condition Variables:

    • Temperature ranges (optimal growth at 83°C with variations)

    • Alternative electron acceptors (sulfate, thiosulfate, nitrate)

    • Carbon source variations

    • Oxygen exposure (A. fulgidus is an anaerobe)

  • Expression Analysis Methods:

    • RT-qPCR for targeted analysis

    • RNA-seq for genome-wide expression profiling

    • Proteomics to confirm translation and potential post-translational modifications

    • Reporter gene fusions to monitor expression in vivo

  • Comparison with Known Regulatory Networks:

    • Compare with the heat shock response pattern (rapid induction at 5 min followed by moderation)

    • Examine potential co-regulation with other membrane proteins

    • Investigate temporal expression patterns during different growth phases

This systematic approach would help establish the regulatory context of AF_1016 expression.

What are the major challenges in working with recombinant AF_1016 and how can they be addressed?

Working with recombinant proteins from hyperthermophilic archaea presents several technical challenges. For AF_1016 specifically, researchers should consider:

  • Protein Solubility Challenges:

    • The hydrophobic regions in AF_1016 may cause aggregation

    • Solution: Screen various detergents and solubilizing agents

    • Methodology: Implement systematic detergent screening using differential scanning fluorimetry

  • Functional Assay Development:

    • The uncharacterized nature makes activity assay development difficult

    • Solution: Develop surrogate assays based on predicted properties

    • Methodology: Screen for binding partners, membrane association, or structural changes under various conditions

  • Thermostability During Manipulation:

    • Proteins from hyperthermophiles may have different stability profiles at mesophilic work temperatures

    • Solution: Optimize buffer conditions to maintain native-like conformations

    • Methodology: Employ thermal shift assays to identify stabilizing buffer components

  • Expression Host Limitations:

    • E. coli lacks archaeal-specific post-translational modifications

    • Solution: Consider archaeal expression systems for native studies

    • Methodology: Develop protocols using Sulfolobus or other cultivable archaeal hosts

  • Reconstitution Challenges:

    • Proper refolding after lyophilization

    • Solution: Follow the specific reconstitution protocol with glycerol addition

    • Methodology: Verify proper folding using circular dichroism or fluorescence spectroscopy

How can researchers verify the correct folding and activity of recombinant AF_1016?

Without known functional activities for AF_1016, verifying correct folding requires indirect approaches:

  • Biophysical Characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to examine tertiary structure through intrinsic tryptophan fluorescence

    • Thermal denaturation profiles to compare with typical archaeal protein stability patterns

  • Structural Integrity Assessment:

    • Size exclusion chromatography to verify monodispersity

    • Dynamic light scattering to assess aggregation state

    • Limited proteolysis to probe for properly folded domains resistant to digestion

  • Functional Surrogate Markers:

    • Membrane association assays if predicted to be membrane-associated

    • Lipid binding assays using fluorescently labeled lipids

    • Thermal stability assays at physiologically relevant temperatures (80-85°C)

  • Comparative Approaches:

    • Express both E. coli-derived and native A. fulgidus-purified protein (if possible)

    • Compare biophysical properties between the two sources

    • Identify any post-translational modifications present only in the native protein

These methodologies provide complementary information about protein quality even in the absence of a defined functional assay.

What are the potential applications of AF_1016 in biotechnology research?

While AF_1016 remains functionally uncharacterized, proteins from hyperthermophilic archaea like A. fulgidus have several potential biotechnological applications:

  • Thermostable Protein Engineering:

    • Use as a scaffold for protein engineering requiring high thermostability

    • Study the structural features contributing to thermostability

    • Develop chimeric proteins incorporating thermostable domains

  • Membrane Protein Research:

    • If confirmed as a membrane protein, use as a model for studying membrane protein folding at high temperatures

    • Develop improved membrane protein expression and purification methods

    • Study lipid-protein interactions under extreme conditions

  • Archaeal Systems Biology:

    • Utilize as a model for studying uncharacterized gene function in archaea

    • Develop tools for functional genomics in hyperthermophiles

    • Contribute to understanding of archaeal membrane composition and function

  • Extremozyme Development:

    • If enzymatic activity is discovered, develop as a thermostable biocatalyst

    • Explore industrial applications requiring high-temperature processes

    • Engineer improved variants with enhanced stability or activity

These applications represent potential research directions pending further characterization of AF_1016's specific properties and functions.

What experimental approaches would be most valuable for future studies of AF_1016?

To advance understanding of AF_1016, future research should prioritize:

  • Comprehensive Functional Screening:

    • Develop a systematic functional screening platform

    • Test for enzymatic activities across major enzyme classes

    • Assess binding to various cellular components (lipids, nucleic acids, proteins)

  • High-Resolution Structural Determination:

    • Optimize conditions for structural studies appropriate to membrane proteins

    • Implement cryo-EM for single-particle analysis if crystallization proves challenging

    • Develop NMR approaches for specific domains or fragments

  • In Vivo Localization and Dynamics:

    • Develop fluorescent protein fusions compatible with hyperthermophilic growth

    • Employ super-resolution microscopy to visualize cellular distribution

    • Use pulse-chase experiments to determine protein turnover rates

  • Systems Biology Integration:

    • Develop interaction networks incorporating AF_1016

    • Identify genetic interactions through synthetic genetic arrays

    • Model potential roles in cellular processes based on multi-omics data integration

  • Evolutionary Analysis:

    • Perform deeper phylogenetic analysis across archaeal lineages

    • Identify conserved features that might suggest functional constraints

    • Trace evolutionary history to identify potential horizontal gene transfer events

These multifaceted approaches would provide complementary insights into the biological role of this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.