Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1096 (AF_1096)

Shipped with Ice Packs
In Stock

Description

Introduction to Archaeoglobus fulgidus and AF_1096

Archaeoglobus fulgidus is a hyperthermophilic archaeon known for its ability to thrive in extremely hot environments, typically around 83°C . It is the first sulfur-metabolizing organism whose genome has been fully sequenced . Within its genome, A. fulgidus possesses a variety of open reading frames (ORFs), some of which encode for uncharacterized proteins. One such protein is AF_1096, also known as Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1096 .

General Characteristics of AF_1096

As an uncharacterized protein, the precise function of AF_1096 in A. fulgidus is not yet known . Proteins like AF_1096 are often targets of structural genomics projects to determine their three-dimensional structure and infer potential functions based on structural similarities to other proteins . Often, these uncharacterized proteins may play a role in the organism's adaptation to its extreme environment, or in other cellular processes .

Role in Heat Shock Response

Studies using whole-genome microarrays to study the heat shock response of A. fulgidus have identified several genes, including AF1298, that exhibit changes in mRNA levels under heat stress . While AF_1096 is not explicitly mentioned as one of the most significantly induced genes during heat shock, these types of studies indicate that a substantial portion of the A. fulgidus genome responds to heat stress, suggesting that AF_1096 could potentially be involved in similar stress responses .

Importance of Studying Uncharacterized Proteins

The study of uncharacterized proteins such as AF_1096 is crucial for a comprehensive understanding of the biology of A. fulgidus. These proteins may have unique functions or represent novel protein folds, expanding our knowledge of protein structure-function relationships . Furthermore, understanding the roles of these proteins may provide insights into the adaptive mechanisms of hyperthermophilic archaea and their potential biotechnological applications .

Methodologies Applied to Study AF_1096

Various experimental techniques are employed to study proteins such as AF_1096:

  • Whole-genome microarray analysis: Used to study gene expression changes in response to environmental stimuli such as heat shock .

  • Cloning and expression: The gene encoding the protein is cloned into an expression vector and expressed in a host organism like E. coli to produce the protein in large quantities .

  • Protein purification: The expressed protein is purified using various chromatographic techniques .

  • Electrophoretic Mobility Shift Assay (EMSA): Used to study the interaction of the protein with DNA .

  • Structural determination: Techniques such as X-ray crystallography are used to determine the three-dimensional structure of the protein .

Future Research Directions

Further research is needed to elucidate the function of AF_1096. This may involve:

  • Determining its crystal structure to gain insights into its potential function .

  • Investigating its interactions with other proteins or DNA .

  • Studying its expression patterns under different environmental conditions .

  • Conducting genetic studies to assess the phenotypic effects of its deletion or overexpression. .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
AF_1096; Uncharacterized protein AF_1096
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1096
Target Protein Sequence
MVRRKMDEKGVSPVIGVILMVAITVILAAVIASFVFGMSNVAPAAPPSAQLQVRTGSSAD TVELKHMGGDPINCTSIKVLVNGKEESNALGSSGGCSDNLLKVGETETITLSGYGGQYVE LTLVDIQTNKPILMTHVTVGG
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1096

STRING: 224325.AF1096

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the structure of Archaeoglobus fulgidus uncharacterized protein AF_1096?

While specific experimental structural data for AF_1096 is limited, researchers typically approach uncharacterized archaeal proteins through computational structure prediction methods similar to those used for other proteins like AF1298. Computational approaches such as AlphaFold can generate predicted structural models with associated confidence metrics (pLDDT scores) that range from 0-100, with higher scores indicating greater reliability . For hyperthermophilic archaeal proteins, these predictions often reveal thermostability-associated structural features such as compact hydrophobic cores and increased salt bridges.

The predicted structural features should be validated through experimental methods like X-ray crystallography or NMR spectroscopy, particularly because computational models of archaeal proteins sometimes have regions with low confidence scores (pLDDT ≤50) that may indicate intrinsically disordered regions or conditional folding dependent on environmental factors .

How does AF_1096 compare to other characterized proteins in Archaeoglobus fulgidus?

Comparative analysis between AF_1096 and characterized A. fulgidus proteins must consider several dimensions:

  • Sequence homology analysis may reveal relationships to characterized proteins like HSR1 (AF1298), which contains a helix-turn-helix DNA binding motif

  • Genomic context analysis, as AF_1096 may be part of an operon structure similar to the AF1298-AF1297-AF1296 arrangement observed in heat shock response studies

  • Domain architecture comparison with proteins of known function

Researchers should note that approximately 14% of A. fulgidus open reading frames show differential expression during heat shock response, spanning functions including energy production, amino acid metabolism, and signal transduction . Most of these ORFs, like AF_1096, remain uncharacterized, suggesting potential functional diversity that requires experimental validation.

What expression patterns does AF_1096 exhibit under different growth conditions?

While specific expression data for AF_1096 is not directly available in the search results, researchers studying expression patterns of uncharacterized A. fulgidus proteins typically employ whole-genome microarray analysis as demonstrated in heat shock studies . This approach can reveal:

  • Temporal expression profiles (similar to the expression curves shown for heat shock proteins peaking at 5 minutes post-stimulus)

  • Differential regulation under various stress conditions

  • Co-expression patterns with functionally related genes

For comprehensive expression analysis, researchers should design experiments that examine multiple conditions relevant to extremophiles, including temperature variations, pH changes, and substrate availability. Time-course sampling is crucial, as A. fulgidus genes like those in the heat shock response show rapid expression changes within 5 minutes followed by gradual reduction over 55 minutes .

What DNA binding motifs might be associated with the regulation of AF_1096?

For archaeal proteins with potential regulatory functions, DNA binding motif identification follows established methodologies:

  • Electrophoretic Mobility Shift Assay (EMSA) to confirm DNA binding capability, using purified recombinant protein and upstream promoter regions of the gene of interest

  • DNase I footprinting to identify protected regions, similar to the approach used for HSR1 protein studies

  • Computational analysis of upstream sequences to identify palindromic motifs like the CTAAC-N5-GTTAG sequence identified in AF1298

Researchers should prepare DNA fragments extending approximately 175 bp upstream and 50 bp downstream relative to the start codon, as this range has proven effective in identifying binding regions for A. fulgidus regulatory proteins . Binding specificity should be established by using non-specific DNA fragments as controls and determining apparent Kd values (~200 nM for specific binding in the case of HSR1 ).

How can AF_1096 be expressed and purified for biochemical characterization?

Recombinant expression and purification of hyperthermophilic archaeal proteins requires specific methodological considerations:

  • Expression system selection: E. coli has been successfully used for A. fulgidus proteins like HSR1 , with codon optimization recommended due to differences in codon usage between archaea and bacteria

  • Expression vector design: For AF_1096, researchers should consider vectors with:

    • Inducible promoters (e.g., T7)

    • Affinity tags for purification (His6 or GST tags)

    • Proteolytic cleavage sites for tag removal

  • Purification protocol:

    • Heat treatment (70-80°C) as an initial purification step, leveraging the thermostability of archaeal proteins

    • Affinity chromatography followed by size exclusion chromatography

    • Buffer optimization to maintain protein stability (typically high ionic strength buffers)

Protein purity should be assessed by SDS-PAGE and activity verified through functional assays relevant to the predicted protein class.

What potential functions can be inferred for AF_1096 based on comparative genomics?

Functional inference for uncharacterized archaeal proteins involves multiple comparative approaches:

  • Homology detection beyond simple BLAST searches:

    • Position-Specific Iterative BLAST (PSI-BLAST)

    • Hidden Markov Models (HMMs)

    • Structure-based alignments

  • Genomic context analysis:

    • Operon structure examination, similar to the AF1298-AF1297-AF1296 operon arrangement

    • Conserved gene neighborhoods across archaeal species

    • Shared regulatory elements

  • Phylogenetic profiling:

    • Co-occurrence patterns with functionally characterized genes

    • Evolutionary conservation across archaeal and bacterial domains

Researchers should note that AF_1096 may belong to evolutionarily diverse protein families similar to HSR1 and Phr from Pyrococcus furiosus, which despite limited sequence similarity share functional roles in hyperthermophilic archaea .

How can transcriptional regulation of AF_1096 be studied in Archaeoglobus fulgidus?

Studying transcriptional regulation of archaeal genes requires specialized approaches:

  • Promoter analysis:

    • Identification of archaeal-specific promoter elements (TATA box, BRE box)

    • Mapping of transcription start sites using 5' RACE

    • Reporter gene assays adapted for extremophiles

  • Transcription factor identification:

    • DNase I footprinting to identify protected regions

    • Protein purification from A. fulgidus cellular extracts using DNA affinity chromatography

    • Mass spectrometry identification of DNA-binding proteins

  • Regulon determination:

    • Chromatin immunoprecipitation followed by sequencing (ChIP-seq) adapted for archaeal systems

    • Whole-genome microarray analysis following perturbation of potential regulators

    • RNA-seq to identify co-regulated genes

When analyzing potential transcription factor binding sites, researchers should look for palindromic motifs (like CTAAC-N5-GTTAG found in AF1298) positioned downstream of putative TATA boxes, as this arrangement has been observed in other A. fulgidus genes .

What structural biology techniques are most appropriate for characterizing AF_1096?

A multi-technique approach to structural characterization offers complementary insights:

  • X-ray crystallography:

    • Optimal for high-resolution structural determination

    • Challenging due to crystallization difficulties with archaeal proteins

    • Sample preparation requires screening multiple crystallization conditions at elevated temperatures

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Provides dynamics information in solution

    • Limited by protein size (~30 kDa upper limit for conventional approaches)

    • Requires isotopic labeling (15N, 13C)

  • Cryo-Electron Microscopy:

    • Appropriate for larger protein complexes

    • Does not require crystallization

    • Resolution has improved significantly in recent years

  • Computational structure prediction:

    • AlphaFold and similar tools provide starting models with confidence metrics (pLDDT)

    • Molecular dynamics simulations to test thermostability

    • In silico docking to predict interaction partners

Researchers should assess confidence metrics carefully, as computational models may have regions with low confidence scores (pLDDT ≤50) that require experimental validation .

How can protein-protein interactions of AF_1096 be identified?

Identifying interaction partners for archaeal proteins requires approaches adapted for extremophiles:

  • Affinity purification-mass spectrometry (AP-MS):

    • Expression of tagged AF_1096 in native or heterologous systems

    • Purification under conditions that maintain native interactions

    • Mass spectrometry identification of co-purified proteins

  • Yeast two-hybrid (Y2H) adaptations:

    • Modified Y2H systems for thermophilic proteins

    • Split-protein complementation assays

    • Bacterial two-hybrid alternatives

  • Crosslinking strategies:

    • In vivo crosslinking followed by purification

    • Chemical crosslinkers with different spacer lengths

    • Photo-activatable crosslinkers for higher specificity

For validation of interactions, researchers should employ reciprocal co-immunoprecipitation, surface plasmon resonance (SPR) for quantitative binding parameters, and functional assays to establish biological relevance.

How should similarities between AF_1096 and other archaeal proteins be evaluated?

Rigorous comparison requires multi-level analysis:

  • Sequence similarity assessment:

    • Multiple sequence alignment with diverse archaeal proteins

    • Conservation analysis of specific residues and motifs

    • Distinction between orthologs and paralogs

  • Structural comparison:

    • Superposition of predicted or experimental structures

    • RMSD calculation for backbone and side chain positions

    • Identification of conserved structural elements despite sequence divergence

  • Functional domain comparison:

    • Recognition of shared functional domains

    • Evaluation of conservation in catalytic or binding sites

    • Analysis of domain architecture differences

Researchers should note that archaeal proteins like HSR1 and Phr from Pyrococcus furiosus may share functional roles despite being only distantly related in sequence , highlighting the importance of structural and functional characterization beyond sequence comparisons.

What bioinformatic approaches are most effective for predicting the function of AF_1096?

Function prediction for archaeal proteins benefits from integrated computational strategies:

  • Sequence-based methods:

    • PSI-BLAST for remote homology detection

    • Conserved domain searches (CDD, Pfam)

    • Motif identification (PROSITE, PRINTS)

  • Structure-based approaches:

    • Fold recognition to identify structural similarities despite low sequence identity

    • Active site geometry comparison

    • Electrostatic surface potential analysis

  • Systems biology integration:

    • Gene neighborhood analysis across archaeal genomes

    • Protein-protein interaction network positioning

    • Co-expression patterns from transcriptomic data

  • Machine learning approaches:

    • Feature-based function prediction algorithms

    • Deep learning methods that integrate multiple data types

    • Classification based on established protein families

These methods should be combined with experimental validation, particularly for archaeal proteins where standard function prediction tools may be less effective due to evolutionary distance from well-characterized model organisms.

How can researchers interpret contradictory experimental results about AF_1096?

Resolving experimental contradictions requires systematic assessment:

  • Methodological differences evaluation:

    • Comparison of experimental conditions (temperature, pH, salt concentration)

    • Assessment of protein preparation methods (tags, purification approaches)

    • Examination of assay sensitivities and limitations

  • Biological context consideration:

    • Different functional states of the protein under varying conditions

    • Potential post-translational modifications

    • Interaction-dependent functional changes

  • Data integration approaches:

    • Weighting evidence based on methodological rigor

    • Meta-analysis of multiple experimental approaches

    • Bayesian integration of contradictory results

When faced with contradictions, researchers should design crucial experiments that specifically address the points of disagreement, preferably using orthogonal techniques that do not share the same potential sources of bias or artifacts.

What gene editing approaches can be used to study AF_1096 function in vivo?

In vivo studies of archaeal genes benefit from emerging genetic tools:

  • CRISPR-Cas9 adaptations for Archaeoglobus:

    • Temperature-stable Cas9 variants

    • Archaeal-specific promoters for guide RNA expression

    • Homology-directed repair templates optimized for GC-rich genomes

  • Traditional gene replacement strategies:

    • Suicide vector approaches

    • Selection markers suitable for hyperthermophiles

    • Counter-selection systems for marker removal

  • Conditional expression systems:

    • Inducible promoters functional at high temperatures

    • Degron tag systems adapted for archaea

    • Antisense RNA approaches

These approaches should be combined with phenotypic assays relevant to predicted functions, including growth rate analysis under various conditions, metabolite profiling, and interaction studies with known cellular pathways.

How might AF_1096 contribute to the extremophilic nature of Archaeoglobus fulgidus?

Analysis of extremophile adaptations requires integrated approaches:

  • Structural adaptation assessment:

    • Identification of thermostability features (increased salt bridges, compact hydrophobic core)

    • Comparison with mesophilic homologs

    • Molecular dynamics simulations at extreme temperatures

  • Functional context evaluation:

    • Expression pattern analysis during stress response

    • Metabolic pathway involvement

    • Potential roles in DNA repair, protein folding, or membrane stability

  • Comparative genomics across extremophiles:

    • Presence of homologs in other extremophiles

    • Correlation with specific environmental adaptations

    • Evolutionary analysis of selection pressure

When studying potential extremophile adaptations, researchers should consider that uncharacterized proteins often represent novel mechanisms for environmental adaptation that may not have parallels in mesophilic organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.