Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1249 (AF_1249)

What is Archaeoglobus fulgidus and why is AF_1249 scientifically significant?

Archaeoglobus fulgidus is a hyperthermophilic, sulphate-metabolizing archaeon, notable as the first sulphur-metabolizing organism to have its genome fully sequenced. Its genome consists of 2,178,400 base pairs containing 2,436 open reading frames (ORFs) . The organism is scientifically significant for several reasons: it provides insights into archaeal biology, extremophile adaptations, and evolution. Approximately 25% (651 ORFs) of the A. fulgidus genome encodes functionally uncharacterized yet conserved proteins , with AF_1249 being one of these proteins.

AF_1249 is particularly interesting because it represents one of many proteins with unknown functions in extremophiles. Understanding its structure and function could provide insights into novel biological mechanisms and potential biotechnological applications related to high-temperature environments.

What are the basic characteristics of the uncharacterized protein AF_1249?

AF_1249 has the following characteristics:

• Length: 140 amino acids (full-length protein)

• UniProt ID: O29019

• Gene Name: AF_1249

• Amino Acid Sequence: MLTRCMGRAFRLSTFFALTTAVTLGIFVISSVYLAHNGIKLPWTSAKIEEGVAHYSVDAITALAITIIAAIPLTAVTERFAKNGELRAYYISFSLILLFFAAVMILLFVNTCSLCSSSCS VRECGVEIALFNAEISCVCQ

• The protein sequence suggests it may contain transmembrane regions, indicating a possible membrane-associated function

• Currently available as recombinant protein with His-tag expressed in E. coli

What is known about the structure of AF_1249?

A computational structure model of AF_1249 has been generated using AlphaFold (model identifier: AF_AFO29019F1) . Key features of this model include:

What are the optimal expression conditions for recombinant AF_1249 protein?

Based on available information about recombinant AF_1249 and similar archaeal proteins, the following expression strategy is recommended:

Expression System Selection:

• E. coli has been successfully used as an expression host for AF_1249

• Various expression vectors can be employed; pBAD/HisA has been used for similar archaeal proteins

Optimization Parameters:

Special Considerations:

• Codon optimization may improve expression in E. coli

• Addition of specific chaperones may help with proper folding

• For membrane proteins like AF_1249, detergent screening may be necessary

Researchers should conduct pilot experiments with various combinations of these parameters to determine optimal conditions for their specific research needs.

What purification strategies yield high-purity AF_1249 protein?

An efficient purification protocol for recombinant His-tagged AF_1249 protein should include:

Initial Purification:

• Cell lysis: Sonication or mechanical disruption in Tris-based buffer with protease inhibitors

• Immobilized metal affinity chromatography (IMAC):

  • Ni-NTA or TALON resin for His-tagged protein

  • Binding in buffer containing 20-50 mM imidazole

  • Washing with increasing imidazole concentrations

  • Elution with 250-500 mM imidazole

Additional Purification Steps:

• Size exclusion chromatography for higher purity and buffer exchange

• Ion exchange chromatography based on predicted isoelectric point

Buffer Optimization:
Current storage buffer used for commercial preparations includes:

• Tris/PBS-based buffer, pH 8.0

• 6% Trehalose for stability

• 50% glycerol recommended for long-term storage

Quality Control:

• SDS-PAGE to confirm purity (>90% achievable)

• Western blotting with anti-His antibodies to confirm identity

• Mass spectrometry for accurate molecular weight determination

Storage Recommendations:

• Store at -20°C/-80°C for long-term storage

• Avoid repeated freeze-thaw cycles

• For working aliquots, store at 4°C for up to one week

What bioinformatic approaches can help predict the function of AF_1249?

A comprehensive bioinformatic workflow to predict AF_1249 function should include:

Sequence-Based Analysis:

• Homology searches using BLAST or HHpred against protein databases

• Multiple sequence alignment with potential homologs to identify conserved residues

• Motif and domain identification using InterPro, PFAM, or PROSITE

• Transmembrane region prediction using TMHMM or Phobius (particularly relevant as the sequence suggests membrane localization)

Structure-Based Analysis:

• Analysis of the AlphaFold structural model (AF_AFO29019F1)

• Structural comparison using DALI or FATCAT to identify structural homologs

• Binding site prediction using CASTp or SiteMap

• Molecular docking simulations with potential ligands

Genomic Context Analysis:

• Examination of neighboring genes in the A. fulgidus genome

• Identification of conserved gene clusters across related species

• Phylogenetic profiling to identify co-evolutionary patterns

By combining these approaches, researchers can generate testable hypotheses about the function of AF_1249, which can then guide experimental validation. The integration of multiple methodologies is crucial for uncharacterized proteins where individual approaches may provide limited insights.

What experimental designs are most appropriate for characterizing the function of AF_1249?

A comprehensive experimental design strategy for functional characterization of AF_1249:

Phase 1: Initial Functional Screening

• Expression Pattern Analysis:

  • RT-qPCR to determine expression levels under different growth conditions

  • RNA-seq to identify co-expressed genes

  • Experimental design: Compare expression in different growth phases, temperatures, and nutrient conditions

• Localization Studies:

  • Fluorescent protein tagging or immunolocalization

  • Membrane fractionation followed by Western blotting

  • Experimental design: Include proper controls for membrane proteins and account for the hyperthermophilic nature of A. fulgidus

• Phenotypic Analysis of Gene Knockout/Knockdown:

  • CRISPR-Cas9 or homologous recombination-based gene disruption

  • Analyze growth, morphology, and stress responses

  • Experimental design: Include complementation controls to confirm phenotype specificity

Phase 2: Detailed Functional Characterization

• Protein-Protein Interaction Studies:

  • Pull-down assays with tagged recombinant protein

  • Yeast two-hybrid or bacterial two-hybrid screening

  • Cross-linking mass spectrometry

  • Experimental design: Include stringent washing steps and appropriate negative controls

• Biochemical Activity Assays:

  • Based on bioinformatic predictions, test for:

    • Enzymatic activity with various substrates

    • Binding to small molecules or nucleic acids

    • Ion channel or transporter activity if membrane-associated

  • Experimental design: Include temperature-dependent activity profiling (25°C to 85°C)

This phased approach allows for progressive refinement of hypotheses about AF_1249 function, with each phase building on insights from previous experiments.

How can researchers investigate potential binding partners of AF_1249?

Identifying binding partners is crucial for understanding the function of uncharacterized proteins. For AF_1249, researchers can employ the following methods:

In Vitro Approaches:

• Affinity Purification-Mass Spectrometry (AP-MS):

  • Express His-tagged AF_1249 as bait

  • Incubate with A. fulgidus cell lysate

  • Purify complexes using Ni-NTA resin

  • Identify interacting proteins via mass spectrometry

  • Experimental design considerations:

    • Use crosslinking agents to capture transient interactions

    • Include stringent controls (e.g., unrelated His-tagged protein)

    • Perform experiments at elevated temperatures to mimic native conditions

• Protein Microarrays:

  • Create arrays of purified A. fulgidus proteins

  • Probe with labeled AF_1249

  • Detect binding using fluorescence or other detection methods

In Vivo Approaches:

• Co-Immunoprecipitation:

  • Generate specific antibodies against AF_1249 (similar to approach used for Afung)

  • Immunoprecipitate native complexes from A. fulgidus

  • Identify partners via mass spectrometry

  • Experimental design considerations:

    • Optimize detergent conditions for membrane protein complexes

    • Validate interactions with reciprocal co-IP

Validation Assays:

• Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry

• Microscale Thermophoresis (MST)

• Isothermal Titration Calorimetry (ITC)

• Experimental design considerations:

  • Test interaction strength at different temperatures

  • Determine binding kinetics and thermodynamics

By combining these approaches, researchers can build a high-confidence interaction network for AF_1249 and gain insights into its cellular function.

What techniques can be used to study the stability of AF_1249 under extreme conditions?

Given that AF_1249 comes from a hyperthermophilic archaeon, understanding its stability under extreme conditions is particularly relevant:

Thermal Stability Analysis:

• Differential Scanning Calorimetry (DSC):

  • Measures heat capacity changes during protein unfolding

  • Experimental design:

    • Temperature range: 25°C to 110°C

    • Buffer conditions: vary pH, salt concentrations

    • Data analysis: determine melting temperature (Tm), enthalpy (ΔH), and entropy (ΔS) changes

• Circular Dichroism (CD) Spectroscopy:

  • Monitors changes in secondary structure during denaturation

  • Experimental design:

    • Far-UV CD (190-260 nm) for secondary structure

    • Temperature ramping experiments

    • Analysis of thermal denaturation curves

Functional Stability:

• Activity Assays at Extreme Conditions:

  • Once a function is identified, measure activity retention

  • Experimental design:

    • Time-course experiments at elevated temperatures

    • Recovery of activity after extreme condition exposure

• Limited Proteolysis:

  • Accessibility of cleavage sites under different conditions

  • Experimental design:

    • Proteolysis at different temperatures

    • Analysis by SDS-PAGE and mass spectrometry

Comparative Stability Analysis:

• Compare with homologs from mesophilic organisms

• Experimental design:

  • Identify key residues associated with thermostability

  • Validate through site-directed mutagenesis

These techniques provide a comprehensive stability profile of AF_1249, offering insights into molecular adaptations enabling function in hyperthermophilic environments.

How can researchers analyze discrepancies between computational predictions and experimental data for AF_1249?

When investigating uncharacterized proteins like AF_1249, researchers often encounter discrepancies between computational predictions and experimental findings:

Structural Discrepancies Resolution:

• Comparison Framework:

  • Create a detailed comparison table:

    Feature	Computational Prediction	Experimental Data	Discrepancy Level	Potential Explanation
    Secondary structure	AlphaFold model prediction	CD spectroscopy results	[Level]	[Explanation]
    Binding site	Predicted binding pocket	Binding assay results	[Level]	[Explanation]
    Stability	Predicted stability	Measured thermal stability	[Level]	[Explanation]

• Refinement of Computational Models:

  • Use experimental constraints to refine the AlphaFold model of AF_1249

  • Incorporate data from:

    • Limited proteolysis experiments

    • Hydrogen-deuterium exchange mass spectrometry

    • Cross-linking mass spectrometry

Functional Discrepancies Analysis:

• Systematic Hypothesis Testing:

  • Design experiments to specifically test computational predictions

  • Experimental design:

    • If predicted to bind specific molecules, test binding panel

    • If predicted to be involved in specific pathways, test for phenotypes

• Environmental Context Consideration:

  • Evaluate whether native conditions are adequately represented:

    • Temperature effects on structure and function

    • Membrane environment for membrane proteins

    • Protein-protein interactions that may be required

By systematically addressing discrepancies, researchers can develop a more accurate understanding of AF_1249's structure and function while generating insights that improve computational prediction methods.

How can CRISPR-Cas systems be adapted for studying AF_1249 in Archaeoglobus fulgidus?

Adapting CRISPR-Cas systems for genetic manipulation in hyperthermophilic archaea like Archaeoglobus fulgidus presents unique challenges:

System Selection and Optimization:

• Thermostable CRISPR-Cas Systems:

  • Identify naturally thermostable Cas proteins from thermophilic organisms

  • Consider systems such as:

    • Cas9 from Geobacillus stearothermophilus (GeoCas9)

    • Cas12a from Acidothermus cellulolyticus (AcCas12a)

    • Native archaeal Cas proteins from related thermophilic archaea

  • Experimental design:

    • Test in vitro activity at A. fulgidus growth temperatures (80-85°C)

    • Optimize guide RNA stability at high temperatures

Gene Editing Strategies for AF_1249:

• Knockout Generation:

  • Design guide RNAs targeting the AF_1249 gene

  • Approaches:

    • Complete gene deletion

    • Frame-shift mutations in early coding regions

    • Targeted disruption of predicted functional domains

  • Example guide RNA design table:

    gRNA ID	Target Sequence	Position in AF_1249	Predicted Efficiency	Off-target Score
    gRNA1	[Sequence]	5' region	[Score]	[Score]
    gRNA2	[Sequence]	Middle region	[Score]	[Score]
    gRNA3	[Sequence]	3' region	[Score]	[Score]

• Gene Replacement/Tagging:

  • Strategies for modifying AF_1249:

    • Incorporate affinity tags for purification/detection

    • Create point mutations in specific domains

    • Replace with variant versions

Phenotypic Analysis of AF_1249 Mutants:

• Growth Phenotype Characterization:

  • Compare wild-type and AF_1249 mutants under various conditions

  • Experimental design:

    • Growth curve analysis across temperature range

    • Stress response testing (pH, salinity, oxidative stress)

    • Nutrient utilization profiling

• Complementation Studies:

  • Restore AF_1249 expression to confirm phenotype specificity

  • Experimental design:

    • Reintroduce wild-type gene under native or inducible promoter

    • Test domain-specific complementation with truncated versions

By developing and applying these CRISPR-Cas strategies, researchers can gain unprecedented insights into the function of AF_1249 through direct genetic manipulation in its native context.