Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1266 (AF_1266)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_1266; Uncharacterized protein AF_1266
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1266
Target Protein Sequence
MELTTPERVLFETEVYEIDDDLKVKRGNVKITESRIMFRSNGNAKLLYISGIQMVEIKKE NRWGFFAGGLIFLVSSAIMYLLGLEFGVGSFTSALMLFVLPTAFLFVSLLLLYWWFVTRS YLLDMHTNFGRKLRIRSKSKEDLYEIANAVELVKMGAVRMLQRKERQFV
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1266

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is AF_1266 significant for research?

Archaeoglobus fulgidus is a hyperthermophilic, sulphate-reducing archaeon with an optimal growth temperature of 83°C. It was the first sulphur-metabolizing organism to have its genome sequence determined, containing 2,178,400 base pairs with 2,436 open reading frames (ORFs) . AF_1266 represents one of many uncharacterized proteins in this extremophile, making it valuable for understanding archaeal metabolism, protein evolution, and adaptations to extreme environments. Approximately a quarter of the A. fulgidus genome (651 ORFs) encodes functionally uncharacterized yet conserved proteins , presenting significant research opportunities for novel protein discovery.

What are the optimal storage conditions for recombinant AF_1266 protein?

Based on protocols for similar A. fulgidus proteins, recombinant AF_1266 should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage and -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can lead to protein degradation and loss of activity . The high thermostability of A. fulgidus proteins generally confers greater storage stability compared to mesophilic proteins, but proper buffer optimization specific to AF_1266 is still recommended.

What expression systems are most suitable for recombinant AF_1266?

E. coli expression systems are most commonly used for A. fulgidus proteins, as demonstrated with other archaeal proteins like AF_2166 and clamp/clamp loader proteins . For optimal expression of hyperthermophilic proteins:

  • Use E. coli strains designed for expression of archaeal proteins (like BL21(DE3) Rosetta)

  • Optimize codon usage for E. coli expression

  • Consider temperature-inducible systems that allow for slow protein folding

  • Design constructs with appropriate tags (His-tags are commonly used)

For AF_1266 specifically, expression as a His-tagged protein in E. coli has been reported successful, yielding full-length protein (amino acids 1-169) .

How can I verify the identity and integrity of recombinant AF_1266?

Verification procedures should include:

  • SDS-PAGE to confirm expected molecular weight

  • Western blotting if antibodies are available

  • Mass spectrometry analysis for protein identification

  • N-terminal sequencing to confirm the absence of degradation

  • Circular dichroism to verify proper folding, especially after purification

For hyperthermophilic proteins like AF_1266, thermal stability assays measuring protein denaturation at increasing temperatures can confirm proper folding, as correctly folded extremophile proteins typically exhibit remarkable thermostability .

What experimental design approaches are most effective for functional characterization of AF_1266?

Effective characterization requires a multi-faceted experimental design approach:

  • Comparative genomic analysis: Identify homologs across species to predict function. Approximately two-thirds of uncharacterized A. fulgidus proteins have homologs in Methanococcus jannaschii , which can provide functional clues.

  • Split-plot experimental design: For testing multiple variables affecting protein function (temperature, pH, substrate concentration). This approach is particularly valuable for experiments with functional responses .

  • Factorial designs: To test interactions between environmental factors affecting protein activity:

Factor CombinationTemperature (°C)Pressure (MPa)pHSalt (M)
Low-Low700.16.00.5
Low-High70406.00.5
High-Low850.17.52.0
High-High85407.52.0
  • Functional data analysis (FDA): For analyzing data collected continuously over time or across conditions. FDA is particularly useful for sensor-streamed data and can detect patterns in protein behavior that might not be apparent in endpoint measurements .

  • Randomized complete block designs: To control for batch effects in protein expression and purification .

How can I determine the physiological role of AF_1266 in A. fulgidus?

Determining the physiological role requires integrative approaches:

  • Growth experiments under varying conditions: Test A. fulgidus growth at different temperatures (70-85°C) and pressures (0.1-60 MPa) to identify conditions where AF_1266 might be differentially expressed . A. fulgidus has been shown to grow heterotrophically up to 60 MPa and autotrophically up to 40 MPa .

  • Gene knockout or silencing studies: While technically challenging in archaea, CRISPR-Cas systems have been adapted for some archaeal species to create gene knockouts.

  • Expression profiling: Measure AF_1266 expression levels under different growth conditions, particularly comparing:

    • Heterotrophic (lactate oxidation coupled to sulfate reduction) vs. autotrophic (CO₂ fixation coupled to thiosulfate reduction) metabolism

    • Different pressure conditions (0.1-60 MPa)

    • Different temperature regimes (70-85°C)

  • Protein-protein interaction studies: Identify binding partners of AF_1266 using pull-down assays with the recombinant protein as bait .

What computational approaches can predict the structure and function of AF_1266?

Advanced computational methods include:

  • Homology modeling: Based on proteins with similar sequences in the PDB database.

  • Ab initio structure prediction: Using modern tools like AlphaFold2 that have significantly improved prediction of archaeal proteins.

  • Molecular dynamics simulations: To model protein behavior under high temperature and pressure conditions mimicking A. fulgidus' natural environment.

  • Active site prediction and docking studies: To identify potential substrates and enzymatic functions.

  • Genomic context analysis: Examining neighboring genes can provide functional insights, as AF_1266 may be part of an operon with functionally related genes. This approach has been successful with other A. fulgidus proteins like the RFC clamp loader complex (encoded by AF1195 and AF2060) .

How do high temperature and pressure conditions affect the stability and activity of recombinant AF_1266?

A systematic approach to studying these effects includes:

  • Differential scanning calorimetry (DSC): To measure thermodynamic parameters of protein unfolding at different pressures.

  • High-pressure enzyme assays: Using specialized equipment to measure activity under simultaneous high temperature and pressure conditions.

  • Pressure perturbation calorimetry: To quantify volume changes during protein unfolding.

A. fulgidus proteins have evolved to function optimally under extreme conditions, with growth observed at temperatures up to 85°C and pressures up to 60 MPa for heterotrophic metabolism . For AF_1266, experimental data tables should be structured to capture activity across the physiologically relevant range:

Temperature (°C)Pressure (MPa)Relative Activity (%)Half-life (hours)
700.1[experimental data][experimental data]
7020[experimental data][experimental data]
7040[experimental data][experimental data]
830.1[experimental data][experimental data]
8320[experimental data][experimental data]
8340[experimental data][experimental data]

What techniques are most reliable for analyzing protein-protein interactions of AF_1266?

For archaeal proteins from extremophiles, special considerations apply:

  • Pull-down assays with recombinant AF_1266: Using His-tagged AF_1266 as bait against A. fulgidus cell lysates prepared under native conditions.

  • Crosslinking studies: Using thermostable crosslinkers that can function at high temperatures.

  • Surface plasmon resonance (SPR): Modified to withstand higher temperatures for studying interactions under near-physiological conditions.

  • Yeast two-hybrid systems: Modified with thermostable components or performed at moderately high temperatures.

  • Co-immunoprecipitation: Using antibodies raised against AF_1266 or its tagged version.

The RFC clamp loader complex from A. fulgidus provides a model for studying protein-protein interactions in this organism, as it involves interactions between the large and small RFC subunits and with PCNA .

How can I design assays to test potential enzymatic functions of AF_1266?

Systematic assay development should include:

  • Bioinformatic prediction of potential activities based on structural motifs or distant homology.

  • High-throughput screening approaches testing multiple potential substrate classes:

    • Hydrolase activities (esterase, protease, glycosidase)

    • Redox activities (oxidoreductase functions)

    • Nucleic acid binding and modification

    • Metabolite interconversion

  • Activity-based protein profiling using chemical probes to identify catalytic activities.

  • Data table analysis using what-if tools to systematically analyze experimental results:

Create an Excel data table to systematically analyze different reaction conditions 16:

  • Set up initial reaction conditions in separate cells

  • List variable values in a column (substrate concentrations, cofactors, etc.)

  • Use Data tab > What-If Analysis > Data Table to generate a comprehensive results table

  • Analyze patterns to identify optimal conditions for AF_1266 activity

What are the best approaches for resolving contradictory data in characterization studies?

When faced with contradictory results:

  • Implement a systematic experimental design review using established methodologies from the design and analysis of experiments (DOE) .

  • Conduct factorial experiments to identify interaction effects between experimental variables that might explain contradictions .

  • Use functional data analysis (FDA) to examine the full trajectory of measurements rather than endpoint data .

  • Apply robust statistical methods specifically developed for complex experimental designs with nested or split-plot structures .

  • Consider the biological context of A. fulgidus as an extremophile. Growth conditions (heterotrophic vs. autotrophic, different pressures) can significantly affect protein expression and function. For example, A. fulgidus exhibits different growth patterns under heterotrophic conditions (optimal at 20 MPa) compared to autotrophic conditions (consistent from 0.3-40 MPa) .

  • Compare methodologies across laboratories and establish standardized protocols for working with hyperthermophilic archaeal proteins to improve reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.