Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1268 (AF_1268)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_1268 (AF_1268) is a hyperthermophilic protein derived from the archaeon Archaeoglobus fulgidus. While its biological function remains uncharacterized, it is commercially available as a recombinant His-tagged protein expressed in E. coli. This protein is part of ongoing research efforts to study uncharacterized proteins in thermophilic organisms, which often harbor unique structural and functional properties suited to extreme environments .

Functional and Pathway Insights

AF_1268 remains uncharacterized, with no documented biochemical activity or pathway involvement. Current research focuses on its structural analysis and potential roles in extremophile biology.

CategoryStatus
Known FunctionsNone documented
Interacting ProteinsUndetermined (no validated interactors reported)
PathwaysHypothetical involvement in unannotated metabolic or stress-response pathways

Note: Pathway annotations are speculative and require experimental validation.

Experimental Uses

  1. Structural Biology: Study of thermophile-specific protein stabilization mechanisms.

  2. Protein-Protein Interactions: Screening for binding partners in A. fulgidus.

  3. Thermostability Assays: Comparative analysis with mesophilic homologs.

Handling Recommendations

ParameterRecommendation
ReconstitutionUse deionized water; avoid denaturants (e.g., SDS, urea).
Long-Term StorageAliquot into 50% glycerol and store at -80°C to preserve activity.
Freeze-Thaw CyclesLimit to ≤2 cycles to prevent aggregation or degradation .

Limitations and Future Directions

While AF_1268 is commercially accessible, critical gaps remain:

  • Functional Elucidation: Requires enzymatic assays or gene knockout studies.

  • Structural Data: Cryo-EM or X-ray crystallography could reveal novel folds.

  • Ecological Relevance: Linking AF_1268 to A. fulgidus’ sulfur metabolism or heat adaptation pathways.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
AF_1268; Uncharacterized protein AF_1268
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1268
Target Protein Sequence
MVSAISTVLYVLIPFLVFLFRRIDARAIMVSGIAFYPFHLFLPMIVVFITGIPLILKSKG VYITLDGIGMENPDFSDALLVIDTMLFQIMLLQPFITLIYSRGVDLKIQDVRLILGTPLR RRILSSLFAFVIAGIALPEIVLLNFSGILHVDYLFFVHLIASSVFANLLVPSDSSKTSLV VFYLWVYIS
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1268

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is AF_1268 and what organism does it come from?

AF_1268 is an uncharacterized protein from Archaeoglobus fulgidus, a hyperthermophilic archaeon. The protein consists of 189 amino acids and has the UniProt ID O29000 . Archaeoglobus fulgidus is known for its heat shock response mechanisms and adaptation to extreme environments, making its proteins of particular interest to researchers studying extremophiles and protein stability .

How is recombinant AF_1268 typically prepared for research?

Recombinant AF_1268 is typically expressed in E. coli with an N-terminal histidine tag to facilitate purification. The protein is supplied as a lyophilized powder that requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add 5-50% glycerol (final concentration) and store aliquots at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

What is currently known about the structure of AF_1268?

While detailed structural information about AF_1268 is limited in the current literature, sequence analysis suggests it contains hydrophobic regions that may indicate membrane association or transmembrane domains. The high proportion of hydrophobic amino acids in the sequence (LYVLIPFLVFLFRR, FYPFHLFLPMIVVFIT, etc.) suggests potential membrane interaction capabilities . Researchers often employ computational prediction tools like TMHMM, Phobius, or TOPCONS to identify potential transmembrane regions before designing experimental approaches.

What functional roles has AF_1268 been associated with?

AF_1268 remains largely uncharacterized functionally. While it is referenced as participating in several pathways, specific pathway associations have not been conclusively established in the current literature . As with many uncharacterized archaeal proteins, determining function often requires comparative genomics approaches, heterologous expression studies, and careful biochemical characterization.

How does AF_1268 compare to other proteins in Archaeoglobus fulgidus?

Within the context of heat shock response studies in Archaeoglobus fulgidus, numerous ORFs show differential expression under stress conditions. While AF_1268 is not specifically mentioned in heat shock response studies, other proteins like HSR1 (from ORF AF1298) contain DNA-binding motifs that suggest regulatory functions . Comparative analysis with other archaeal proteins may provide insights into potential functional roles of AF_1268.

What expression systems are most effective for producing recombinant AF_1268?

E. coli has been successfully used as an expression host for recombinant AF_1268 with a histidine tag . When designing expression systems for archaeal proteins, researchers should consider:

  • Codon optimization for the host organism

  • Expression temperature adjustments (especially important for thermophilic proteins)

  • Selection of appropriate fusion tags (His-tag is commonly used as demonstrated with AF_1268)

  • Inclusion of solubility-enhancing partners if expression yields insoluble protein

The choice between prokaryotic (E. coli) versus eukaryotic expression systems should be based on downstream applications and the need for post-translational modifications.

What purification strategies are recommended for AF_1268?

Based on the His-tagged recombinant form of AF_1268, immobilized metal affinity chromatography (IMAC) is the primary purification method. A comprehensive purification protocol would typically include:

  • Cell lysis under conditions that maintain protein stability

  • IMAC purification using Ni-NTA or similar resin

  • Buffer exchange to remove imidazole

  • Secondary purification step such as ion exchange or size exclusion chromatography

  • Quality assessment via SDS-PAGE (>90% purity has been reported)

  • Concentration determination and storage optimization

How should researchers approach functional characterization of this uncharacterized protein?

A systematic approach to characterizing AF_1268 would include:

  • Bioinformatic analysis for domain prediction and homology modeling

  • Localization studies using fluorescently tagged constructs or subcellular fractionation

  • Protein-protein interaction studies using pull-down assays, yeast two-hybrid, or co-immunoprecipitation

  • Gene knockout or knockdown studies in native organism (if genetic tools exist)

  • Heterologous expression followed by phenotypic analysis

  • Biochemical assays based on predicted function from sequence analysis

What structural biology techniques are most appropriate for studying AF_1268?

Given the potential membrane association of AF_1268 based on its hydrophobic sequence components, researchers should consider:

  • X-ray crystallography of soluble domains (if identifiable)

  • NMR spectroscopy for solution structure determination

  • Cryo-electron microscopy if the protein forms larger complexes

  • Circular dichroism (CD) spectroscopy for secondary structure analysis

  • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

  • Molecular dynamics simulations based on homology models

For membrane-associated regions, specialized techniques such as solid-state NMR or lipid cubic phase crystallization may be necessary.

How can researchers investigate potential interaction partners of AF_1268?

To identify protein-protein interactions involving AF_1268, researchers should consider:

  • Pull-down assays using His-tagged AF_1268 as bait

  • Crosslinking studies followed by mass spectrometry

  • Yeast two-hybrid screening if suitable nuclear localization can be achieved

  • Co-immunoprecipitation with antibodies raised against AF_1268

  • Proximity labeling approaches (BioID or APEX) in heterologous systems

  • Surface plasmon resonance for quantitative binding analysis of candidate partners

These approaches can help build an interaction network that may provide functional insights.

What considerations should be made when designing site-directed mutagenesis experiments for AF_1268?

When planning mutagenesis studies, researchers should:

  • Target conserved residues identified through multiple sequence alignments

  • Analyze the predicted structure for potential functional sites

  • Focus on hydrophobic regions that may be involved in membrane association

  • Consider charge-altering mutations in regions with clustered charged residues

  • Design mutations that disrupt potential secondary structure elements

  • Include appropriate controls (conservative vs. non-conservative substitutions)

Following mutagenesis, functional assays should be developed to assess the impact of mutations on protein activity, localization, or interaction capabilities.

What are the challenges in expressing and purifying AF_1268 for research purposes?

Key challenges researchers may encounter include:

  • Protein solubility issues due to hydrophobic regions

  • Proper folding at mesophilic temperatures when expressed in E. coli

  • Potential toxicity to host cells if the protein disrupts membrane integrity

  • Low expression yields requiring optimization of induction conditions

  • Protein instability during purification processes

  • Buffer incompatibilities affecting downstream applications

To address these challenges, researchers often need to optimize expression conditions, try different fusion tags, or use specialized host strains designed for difficult-to-express proteins.

How can researchers develop reliable antibodies against AF_1268?

Developing antibodies against archaeal proteins presents several challenges:

  • Identify antigenic regions using epitope prediction software

  • Consider synthesizing peptides from hydrophilic regions for immunization

  • Use the purified recombinant protein for polyclonal antibody production

  • Validate antibody specificity using western blotting of recombinant protein

  • Test cross-reactivity with other archaeal proteins

  • Optimize immunohistochemistry or immunofluorescence protocols for subcellular localization studies

Commercial antibody production services may require custom protocols for archaeal proteins with unusual properties.

What analytical methods are recommended for assessing the purity and stability of AF_1268 preparations?

For quality control of AF_1268 preparations, researchers should employ:

  • SDS-PAGE for purity assessment (>90% purity is achievable)

  • Western blotting with anti-His antibodies to confirm identity

  • Size exclusion chromatography to evaluate aggregation state

  • Dynamic light scattering for homogeneity analysis

  • Thermal shift assays to determine stability under various buffer conditions

  • Mass spectrometry for accurate mass determination and potential post-translational modifications

How might AF_1268 contribute to our understanding of archaeal membrane biology?

As a potential membrane-associated protein from a hyperthermophilic archaeon, AF_1268 may provide insights into:

  • Membrane adaptations in extremophiles

  • Protein-lipid interactions at high temperatures

  • Evolutionary conservation of membrane protein structures across domains of life

  • Archaeal-specific membrane protein folding and stability mechanisms

  • Unique signaling or transport functions in archaeal membranes

  • Structural adaptations that permit function under extreme conditions

Comparative studies with mesophilic homologs, if identifiable, could reveal thermoadaptation mechanisms.

What computational approaches are valuable for predicting AF_1268 function?

In silico approaches to function prediction include:

  • Remote homology detection using sensitive sequence comparison tools (PSI-BLAST, HHpred)

  • Structural modeling followed by binding site prediction

  • Genomic context analysis to identify functional associations

  • Co-expression network analysis if transcriptomic data is available

  • Evolutionary rate analysis to identify functionally constrained regions

  • Molecular docking with potential ligands based on structural predictions

These computational approaches can generate testable hypotheses about protein function.

How can researchers leverage AF_1268 in studies of extremophile adaptation?

AF_1268 could serve as a model protein for understanding:

  • Sequence and structural features that confer thermostability

  • Membrane protein adaptation in thermophiles

  • Evolution of uncharacterized protein families in extremophiles

  • Functional redundancy or specialization in archaeal genomes

  • Biotechnological applications requiring stable proteins

  • Fundamental principles of protein stability under extreme conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.