Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1283 (AF_1283)

Shipped with Ice Packs
In Stock

Description

Basic Characteristics of AF_1283

AF_1283 is encoded by the gene AF_1283 in A. fulgidus (UniProt ID: O28985) and belongs to a family of uncharacterized proteins. Key attributes include:

PropertyValueSource
Gene IDAF_1283
Protein LengthFull-length (1–100 amino acids)
Host SystemsE. coli (full-length), mammalian cells (partial)
TagN-terminal His-tag (for E. coli expression)
Purity>90% (SDS-PAGE)
Amino Acid SequenceMGETSVTLIGLIVGLLFGLSGIATLLSLMSDVVSDAQAQLSQLGVASTLVMLVIALILII KVRVLSALIVGAVIGAVLNLVLQANGVNILEMLRAAVFGT

Amino Acid Sequence

The full-length protein (1–100 aa) includes hydrophobic regions (e.g., LIVGLLFGLSG) and potential β-strand/α-helix domains. The partial version (CSB-MP518092DOC1) lacks complete structural data .

Molecular Weight

While not explicitly stated, the sequence length (100 aa) suggests a molecular weight of ~11 kDa (average aa molecular weight = 110 Da).

Production and Quality Control

Recombinant AF_1283 is produced via heterologous expression systems, ensuring high purity and scalability:

ParameterE. coli Expression (Full-Length)Mammalian Cell Expression (Partial)
TagHis-tagUndisclosed
Purity MethodSDS-PAGE (>90%)SDS-PAGE (>85%)
YieldLyophilized powderLyophilized or liquid
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0Not specified

Data sourced from .

Research Applications and Potential

While AF_1283’s biological role is uncharacterized, its recombinant form enables:

  1. Structural Studies: Crystallization and NMR/EM analysis to resolve 3D conformation.

  2. Functional Screening: Biochemical assays to identify interactions (e.g., DNA binding, enzyme activity).

  3. Pathway Mapping: Co-expression with archaeal proteins to infer participation in metabolic or stress-response pathways.

Current Research Gaps

  • Functional Annotation: No studies directly link AF_1283 to specific processes (e.g., DNA repair, metabolism).

  • Interaction Partners: Limited data on binding partners or cofactors.

  • In Vivo Relevance: Role in A. fulgidus’ adaptation to hyperthermophilic environments remains speculative.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AF_1283; Uncharacterized protein AF_1283
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1283
Target Protein Sequence
MGETSVTLIGLIVGLLFGLSGIATLLSLMSDVVSDAQAQLSQLGVASTLVMLVIALILII KVRVLSALIVGAVIGAVLNLVLQANGVNILEMLRAAVFGT
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1283

STRING: 224325.AF1283

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.