Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1457 (AF_1457)

Shipped with Ice Packs
In Stock

Description

Definition and Recombinant Production

AF_1457 is a recombinant protein expressed in Escherichia coli as a full-length construct (1–105 amino acids) with an N-terminal His-tag for purification . Its UniProt identifier is O28815, and it is annotated as an uncharacterized protein in genomic databases .

ParameterDetail
SpeciesArchaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304)
Expression HostE. coli
TagN-terminal His-tag
Protein LengthFull-length (1–105 aa)
Purity≥90% (SDS-PAGE) ; ≥85%

Key Features:

  • Secondary Structure: No experimental data available; sequence analysis suggests potential helical or β-sheet regions.

  • Stability: Lyophilized powder stored at -20°C/-80°C; repeated freeze-thaw cycles are discouraged .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Functional Insights and Research Applications

While AF_1457 remains functionally uncharacterized, its recombinant availability supports exploratory research:

Hypothesized Roles (Based on Sequence Homology):

  • Protein Interactions: Potential involvement in intra-cellular processes (e.g., DNA repair, metabolic regulation), though no homologs with defined functions have been identified .

  • Enzymatic Activity: No catalytic activity reported; experimental validation required.

Research Applications:

ApplicationDetails
ELISA DevelopmentServes as an antigen for antibody production and immunoassays .
Structural StudiesCrystallization or NMR studies to resolve tertiary structure.
Interaction MappingCo-IP or pull-down assays to identify binding partners .

Research Gaps and Future Directions

  • Functional Elucidation: No studies have linked AF_1457 to specific biochemical pathways or cellular processes.

  • Structural Determination: X-ray crystallography or cryo-EM could resolve its 3D structure.

  • Homology-Based Inference: Comparative genomics may identify conserved motifs or homologs in other archaea.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize development accordingly.
Synonyms
AF_1457; Uncharacterized protein AF_1457
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1457
Target Protein Sequence
MDARDIVLSVISVFSAAALVYRWLSLYDRVDMTVIFFATLLIASLTLLLISIELRMQRIM DEFKSVKRTIAVNSDDLEGRIERLFIEKVRDLEDKLESIERRMYR
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1457

STRING: 224325.AF1457

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the genomic context of AF_1457 in Archaeoglobus fulgidus?

While specific information about AF_1457 is limited in the literature, researchers can gain insights by examining the genomic neighborhood of this gene. In similar studies of A. fulgidus proteins, genomic context analysis has proven valuable. For example, the characterization of the ferric reductase encoded by the AF0830 gene involved N-terminal sequence analysis that matched to the genome sequence, confirming its identity . For AF_1457, researchers should:

  • Analyze flanking genes to identify potential operonic structures

  • Examine promoter regions for regulatory elements

  • Compare synteny with related archaea to identify conserved genomic neighborhoods

  • Assess potential horizontal gene transfer events using phylogenetic approaches

This contextual information often provides the first clues about potential functions, especially for uncharacterized proteins from extremophiles like A. fulgidus.

What expression systems are most effective for recombinant production of Archaeoglobus fulgidus proteins?

Expression of hyperthermophilic archaeal proteins presents unique challenges due to their extreme stability requirements and post-translational modifications. Based on successful expression of other A. fulgidus proteins such as the ferric reductase, the following expression systems are recommended:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coli BL21(DE3)High yield, simple cultivationMay form inclusion bodiesLower temperature induction (16-20°C)
E. coli RosettaEnhanced translation of rare codonsMore expensiveEssential for archaeal codon usage
Sulfolobus solfataricusNative-like post-translational modificationsComplex cultivationRequires specialized equipment
Cell-free systemsAvoids toxicity issuesLower yieldUseful for toxic proteins

For AF_1457, initial screening in E. coli Rosetta strains at reduced induction temperatures (16-20°C) is recommended, followed by optimization of solubility conditions and buffer compositions that reflect the native hyperthermophilic environment.

What purification methods are most suitable for AF_1457 from Archaeoglobus fulgidus?

Purification of hyperthermophilic proteins benefits from their inherent stability at high temperatures. Based on successful purification strategies for other A. fulgidus proteins, a multi-step purification protocol is recommended:

  • Heat treatment (75-80°C) of cell lysate to precipitate most host proteins

  • Initial capture using ion exchange chromatography (based on predicted pI)

  • Intermediate purification using hydrophobic interaction chromatography

  • Polishing step with size exclusion chromatography

For the ferric reductase from A. fulgidus, researchers achieved 175-fold purification to homogeneity using a combination of these methods . The native enzyme was determined to be a homodimer with a molecular weight of approximately 40,000 Da, while the subunit size was approximately 18,000 Da . Similar approaches would likely be effective for AF_1457, with modifications based on its predicted properties.

How can researchers determine the biological function of the uncharacterized protein AF_1457?

Determining the function of uncharacterized proteins from extremophiles requires a multi-faceted approach:

  • Bioinformatic prediction:

    • Sequence similarity networks with known proteins

    • Structural homology modeling

    • Protein domain identification

    • Phylogenetic profiling

  • Biochemical characterization:

    • Substrate screening panels

    • Enzymatic activity assays at varying temperatures (optimal likely 85-90°C)

    • Cofactor requirement analysis

    • Metal ion dependency tests

  • Structural analysis:

    • X-ray crystallography (with and without potential substrates)

    • NMR spectroscopy for dynamics studies

    • Cryo-EM for larger complexes

  • In vivo studies:

    • Gene knockout/knockdown analysis

    • Protein-protein interaction studies

    • Transcriptional analysis under varying growth conditions

For context, the ferric reductase from A. fulgidus was identified as a novel enzyme despite sequence similarity to NAD(P)H:FMN oxidoreductases . It required detailed enzymatic characterization to reveal its unique ability to reduce Fe(3+)-EDTA using both NADH and NADPH as electron donors, with a strict requirement for FMN or FAD as catalytic intermediates .

What structural adaptations might AF_1457 possess that enable function at extreme temperatures?

Hyperthermophilic proteins employ several structural adaptations to maintain stability at extreme temperatures. For AF_1457, researchers should investigate:

Adaptation MechanismExperimental ApproachExpected Observations
Increased ionic interactionsIon-pair analysis via structural studiesHigher density of salt bridges compared to mesophilic homologs
Enhanced hydrophobic core packingFluorescence spectroscopy with hydrophobic probesGreater resistance to chemical denaturation
Reduced surface loopsLimited proteolysis experimentsFewer proteolytically sensitive regions
Disulfide bond stabilizationCysteine modification studiesStrategic disulfide bonds in tertiary structure
Proline substitutions in loopsCircular dichroism at varying temperaturesIncreased rigidity of secondary structure elements

The ferric reductase from A. fulgidus demonstrates remarkable thermostability with a temperature optimum of 88°C and a half-life of 2 hours at 85°C . Similar thermostability assessment should be conducted for AF_1457, with careful consideration of buffer compositions that support protein integrity at these extreme temperatures.

How might AF_1457 integrate into the metabolic network of Archaeoglobus fulgidus?

Understanding the metabolic context of AF_1457 requires consideration of A. fulgidus' unique physiology as a hyperthermophilic sulfate-reducing archaeon:

  • Potential roles in energy metabolism:

    • Electron transfer components (similar to the characterized ferric reductase)

    • Alternative respiratory pathways under varying redox conditions

    • Stress response mechanisms to oxidative damage

  • Metabolic integration approaches:

    • Metabolomics analysis comparing wild-type and AF_1457 knockout strains

    • Proteomics to identify interaction partners

    • Transcriptional co-regulation studies

    • Metabolic flux analysis under varying growth conditions

  • Biochemical interaction studies:

    • Pull-down assays to identify protein complexes

    • Blue native PAGE for native complex identification

    • Crosslinking mass spectrometry to map interaction surfaces

The characterized ferric reductase in A. fulgidus plays a role in iron metabolism, specifically reducing Fe(3+)-EDTA and other Fe(3+) complexes, but not uncomplexed Fe(3+) . This selectivity suggests specialized metabolic roles that should be considered when investigating AF_1457's potential function.

What specialized techniques are required for assessing enzyme activity at extreme temperatures?

Working with hyperthermophilic enzymes requires adaptation of standard enzymatic assays:

  • High-temperature spectrophotometric assays:

    • Use of sealed cuvettes to prevent evaporation

    • Pre-equilibration of all reagents at assay temperature

    • Temperature-controlled spectrophotometer chambers

    • Correction for temperature effects on chromophore properties

  • Oxygen sensitivity considerations:

    • Anaerobic chambers for oxygen-sensitive reactions

    • Oxygen-scavenging systems in buffers

    • Pre-degassing of all solutions

  • Stability of assay components:

    • Verification of substrate stability at high temperatures

    • Use of thermostable coupled enzyme systems

    • Time-course measurements to account for thermal degradation

For the A. fulgidus ferric reductase, researchers determined its temperature optimum at 88°C and measured enzyme activity half-life at 85°C . Similar careful temperature control and stability assessments would be essential for characterizing AF_1457.

How can researchers differentiate between structural features that contribute to thermostability versus those essential for catalytic function?

Distinguishing thermostability determinants from catalytic features requires targeted experimental approaches:

  • Site-directed mutagenesis strategies:

    • Systematic alteration of charged residues in potential ion pairs

    • Substitution of conserved hydrophobic residues

    • Introduction of glycine residues in rigid regions

    • Removal/addition of proline residues in loops

  • Comparative analysis workflow:

    • Identify mesophilic homologs with similar function

    • Create chimeric proteins with domain swapping

    • Measure both thermostability and catalytic parameters

    • Perform molecular dynamics simulations at different temperatures

  • Structure-guided experimental design:

    • Crystallize protein at different temperatures

    • Conduct hydrogen-deuterium exchange mass spectrometry

    • Analyze B-factors in crystal structures as flexibility indicators

    • Use NMR to identify dynamic regions at different temperatures

The A. fulgidus ferric reductase represents an excellent example of a thermostable enzyme with unique catalytic properties, sharing sequence similarity with NAD(P)H:FMN oxidoreductases while possessing novel ferric reductase activity . This highlights how comparative approaches can reveal both structural adaptations and catalytic innovations.

What approaches can help resolve contradictory data in functional characterization studies?

Researchers often encounter contradictory results when characterizing novel proteins from extremophiles. The following methodology can help resolve such discrepancies:

  • Systematic validation protocol:

    • Verify protein identity via mass spectrometry

    • Confirm homogeneity by multiple methods (SEC, DLS, native PAGE)

    • Assess batch-to-batch variability in activity assays

    • Control for trace contaminants from expression host

  • Multi-method orthogonal validation:

    • Combine biochemical, biophysical, and structural approaches

    • Verify in vitro findings with complementary in vivo experiments

    • Use both heterologous expression and native protein purification

    • Apply isothermal titration calorimetry to directly measure binding events

  • Critical assessment of experimental conditions:

    • Evaluate buffer composition effects on activity

    • Test influence of reducing agents on protein behavior

    • Examine metal ion dependencies under strictly controlled conditions

    • Consider oxygen sensitivity even for presumed aerobic proteins

When the A. fulgidus ferric reductase was characterized, researchers conducted careful controls to determine that it strictly requires FMN or FAD as catalytic intermediates and that it uses both NADH and NADPH as electron donors . Similar rigorous validation would be essential for resolving any contradictory data in the characterization of AF_1457.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.