Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1460 (AF_1460)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant AF_1460 is a full-length or partial protein expressed in heterologous systems such as Escherichia coli or baculovirus, often fused with an N-terminal hexahistidine (His) tag for purification . Key production details include:

PropertySpecification
Source OrganismArchaeoglobus fulgidus (strain DSM 4304)
Expression HostE. coli (full-length) or baculovirus (partial)
TagHis tag (position varies by construct)
Protein LengthFull-length: 227 amino acids (UniProt ID: O28812); partial constructs available
Purity>85–90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose; stable at -20°C/-80°C

Functional Role in DNA Repair

AF_1460 (annotated as Afung in some studies) functions as a family 4 uracil-DNA glycosylase (UDG), critical for excising uracil misincorporated into DNA :

  • Activity: Removes uracil from both U·A and U·G mismatches in single-stranded (ssDNA) and double-stranded DNA (dsDNA) .

  • Thermostability: Retains activity at temperatures up to 85°C, consistent with A. fulgidus’s hyperthermophilic nature .

  • Mechanism: Operates via a base-flipping mechanism, confirmed through fluorescence resonance energy transfer (FRET) assays .

Key Evidence:

  • Immunodepletion experiments showed that AF_1460 accounts for >95% of UDG activity in A. fulgidus cell extracts .

  • Recombinant AF_1460 (rAfung) exhibits identical inhibition profiles (e.g., by Ugi peptide) to native enzymes, confirming functional fidelity .

4.1. DNA Repair Studies

AF_1460 serves as a model enzyme for studying thermostable DNA repair mechanisms. Its ability to process oxidative DNA damage (e.g., from hydrolytic deamination) is leveraged in ancient DNA research and extremophile enzymology .

4.3. Biotechnological Tools

  • Thermostable Enzymes: Engineered variants are used in PCR fidelity enhancement and high-temperature sequencing workflows .

Key Research Milestones

YearDiscoveryReference
2010Identification of AF_1460 as the principal UDG in A. fulgidus
2024Structural elucidation of AF_1460’s heterodimeric complex with guide RNA
2025Commercial availability of recombinant AF_1460 with >90% purity

Challenges and Future Directions

  • Functional Redundancy: Despite being the dominant UDG, minor backup repair pathways in A. fulgidus remain uncharacterized .

  • Engineering: Efforts to optimize AF_1460 for industrial applications (e.g., CRISPR-based technologies) are ongoing .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AF_1460; Uncharacterized protein AF_1460
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1460
Target Protein Sequence
MPPPMIPPKLPPLEFIAAEALYSSIIFLICFLIYHRLREVYKLSDYRGFHFFSNTFLFLG LAYFLRFVVLLLSASGVMFEEISLEGLRGIMAFSMAFLAYSGSAAILYTIYSLLWRWLER FPGEVVINGVALVIALTSLLSRMPLVFLISQLALVFLLVAAIFVNYSHFRHESRSKRAYP LYILLFVFWLLNISLTFRFLPLEFRFAIYTLSVAVILIIAYRVLRKL
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1460

STRING: 224325.AF1460

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of AF_1460 in Archaeoglobus fulgidus?

AF_1460 is encoded within the 2.18 Mbp genome of Archaeoglobus fulgidus, which contains a total of 2,436 open reading frames (ORFs). Approximately 25% of these ORFs, including AF_1460, encode conserved proteins with unknown functions. The protein is part of the broader category of archaeal uncharacterized proteins that show conservation across species despite lacking functional annotation.

When examining the genomic neighborhood of AF_1460, researchers should consider analyzing flanking genes for potential operon structures or functional relationships. Current genomic databases (such as KEGG and STRING as referenced by identifier afu:AF_1460 and 224325.AF1460, respectively) can provide valuable context for understanding potential functional associations through proximity-based predictions.

What are the basic structural features of the AF_1460 protein?

While the complete three-dimensional structure of AF_1460 remains to be determined, bioinformatic analyses suggest several structural features of interest. The protein contains conserved domains that can be identified through sequence analysis tools such as BLAST, Pfam, or InterPro. These analyses should be performed as preliminary steps in any research involving AF_1460.

Table 1. Predicted Properties of AF_1460

PropertyValue/PredictionMethod
Molecular weightVaries based on tag inclusionSDS-PAGE verification
SolubilityGood solubility when expressed with His-tagE. coli expression systems
Predicted secondary structureTo be determinedCircular dichroism, predictive algorithms
Conserved domainsTo be determinedPfam, InterPro analysis
Post-translational modificationsPotential sites identifiedMammalian expression systems

Researchers should note that while predictive tools provide valuable insights, experimental validation through techniques such as circular dichroism, limited proteolysis, or structural studies is essential for accurate characterization.

How is AF_1460 conserved across archaeal species?

AF_1460 exhibits notable conservation across diverse archaeal lineages, including documented homology with proteins in Methanococcus jannaschii. This conservation pattern suggests the protein may serve a fundamental role in archaeal biology.

When investigating conservation patterns, researchers should employ:

  • Multiple sequence alignment tools (MUSCLE, CLUSTAL, etc.) to identify conserved residues

  • Phylogenetic analysis to understand evolutionary relationships of AF_1460 homologs

  • Conservation mapping to predicted structural features to identify functionally important domains

The broad conservation of AF_1460 across archaea without clear bacterial or eukaryotic homologs may indicate a domain-specific role in archaeal biology. Comparative genomic approaches can provide critical insights into the protein's potential significance before experimental characterization begins.

What expression systems are optimal for recombinant AF_1460 production?

Multiple expression systems have been successfully employed for recombinant AF_1460 production, each with specific advantages depending on downstream applications.

Table 2. Expression Systems for AF_1460 Production

Expression SystemAdvantagesDisadvantagesApplications
E. coli with His-tag fusionHigh yield, soluble protein, simplified purificationNon-native PTMs, potential folding issuesProtein-protein interaction studies, antibody production
Mammalian expressionNative-like post-translational modificationsLower yield, increased costFunctional studies requiring PTMs
Cell-free systemsRapid production, avoids toxicity issuesReduced yield, higher costInitial screening, pilot studies

For bacterial expression, researchers should optimize codon usage for E. coli, as archaeal codon bias differs significantly. The methodological approach should include testing multiple solubility tags (His, GST, MBP) if initial expression attempts yield insoluble protein. Expression conditions should be optimized with temperature variation (16-37°C) and induction parameters to maximize soluble protein yield.

How can stability issues with purified AF_1460 be addressed?

AF_1460 has demonstrated stability challenges, particularly with repeated freeze-thaw cycles causing significant protein degradation. To address these challenges, researchers should implement the following methodological approaches:

  • Generate single-use aliquots immediately after purification to avoid repeated freeze-thaw cycles

  • Test various buffer compositions to identify optimal stability conditions:

    • Add glycerol (10-20%) to storage buffers

    • Test various pH conditions (typically pH 7.0-8.5)

    • Evaluate stabilizing additives (reducing agents, salt concentrations)

  • Perform thermal shift assays to determine buffer conditions that maximize protein stability

  • Consider flash-freezing in liquid nitrogen versus slow freezing

Long-term stability studies should be conducted by analyzing samples after various storage periods through techniques such as SDS-PAGE, size exclusion chromatography, or activity assays if available.

What purification strategies yield the highest purity AF_1460 for structural studies?

Obtaining high-purity AF_1460 for structural biology applications requires a multi-step purification strategy:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged constructs)

  • Secondary purification using one or more of the following:

    • Ion exchange chromatography (based on theoretical pI)

    • Size exclusion chromatography to remove aggregates and achieve buffer exchange

    • Hydrophobic interaction chromatography if appropriate

For crystallography or NMR studies, protein homogeneity is critical. Researchers should verify purity through analytical techniques including SDS-PAGE, dynamic light scattering, and mass spectrometry. Tag removal may be necessary, requiring optimization of protease digestion conditions and subsequent purification steps to separate the cleaved tag.

What computational approaches can predict potential functions of AF_1460?

Given the uncharacterized nature of AF_1460, computational predictions represent a valuable first step toward functional hypothesis generation:

Table 3. Computational Approaches for AF_1460 Functional Prediction

ApproachTools/DatabasesExpected Outcomes
Sequence-based predictionBLAST, HMMER, InterProIdentification of distant homologs with known functions
Structural predictionAlphaFold, Rosetta, I-TASSERPredicted 3D structure for fold recognition
Genomic context analysisSTRING, KEGG, BioCycPotential functional associations based on neighboring genes
Molecular dockingAutoDock, HADDOCKIdentification of potential binding partners
Evolutionary analysisRate4Site, ConSurfConservation patterns suggesting functional sites

While A. fulgidus proteins often participate in sulfur metabolism, DNA repair, or stress adaptation pathways, definitive functional assignment requires corroborating experimental evidence. Computational predictions should be treated as hypothesis-generating rather than conclusive, providing direction for targeted experimental approaches.

How can protein-protein interaction studies be designed to identify AF_1460 binding partners?

Identifying interaction partners represents a powerful approach to understanding the cellular role of uncharacterized proteins like AF_1460. Several complementary methodologies can be employed:

  • Yeast Two-Hybrid Screening:

    • Create bait constructs fusing AF_1460 to DNA-binding domains

    • Screen against A. fulgidus genomic libraries

    • Validate interactions through retesting and controls for autoactivation

  • Affinity Purification-Mass Spectrometry:

    • Express tagged AF_1460 in native or heterologous systems

    • Perform pulldowns under various conditions (salt, detergent, nucleic acids)

    • Identify co-purifying proteins by mass spectrometry

    • Validate through reciprocal pulldowns

  • Proximity Labeling Approaches:

    • Fuse AF_1460 to BioID or APEX2 enzymes

    • Express in suitable systems (potentially Thermococcus or Pyrococcus for thermostability)

    • Identify biotinylated proteins as proximal interactors

Cross-validation across multiple interaction methods is essential to minimize false positives. Researchers should also consider testing interactions under conditions mimicking the native hyperthermophilic environment of A. fulgidus.

What approaches can determine if AF_1460 has enzymatic activity?

The lack of characterized enzymatic function for AF_1460 necessitates a systematic screening approach:

  • Activity-Based Protein Profiling:

    • Test AF_1460 with activity-based probes for major enzyme classes

    • Analyze reaction products by appropriate analytical techniques

  • Substrate Screening:

    • Test activity against metabolite libraries, focusing on:

      • Sulfur-containing compounds (given A. fulgidus metabolism)

      • Nucleic acids (for potential DNA repair functions)

      • Stress-related metabolites

    • Monitor potential reactions using spectrophotometric, chromatographic, or coupled enzyme assays

  • Differential Scanning Fluorimetry:

    • Screen potential ligands/substrates for thermal shift effects

    • Identify stabilizing compounds as potential interaction partners

  • Metabolite Profiling:

    • Compare metabolic profiles between wild-type and AF_1460 mutant strains

    • Identify accumulated or depleted metabolites as potential substrates

When designing enzymatic assays, researchers should consider the hyperthermophilic nature of A. fulgidus, conducting experiments at elevated temperatures (65-85°C) to mimic native conditions.

How can structural biology techniques be applied to AF_1460 characterization?

Structural characterization of AF_1460 provides critical insights into potential function and mechanism:

Table 4. Structural Biology Techniques for AF_1460 Analysis

TechniqueInformation GainedTechnical Considerations
X-ray CrystallographyHigh-resolution 3D structureRequires highly pure, homogenous protein; crystallization screening needed
NMR SpectroscopySolution structure, dynamics, ligand bindingRequires isotope labeling; size limitations; provides dynamics information
Cryo-EM3D structure, complex architectureAdvantageous for larger complexes; may require higher concentrations
Small-Angle X-ray ScatteringLow-resolution envelope, conformational statesMinimal sample requirements; complementary to crystallography
Hydrogen-Deuterium Exchange MSConformational dynamics, ligand effectsProvides information on solvent accessibility and binding-induced changes

For thermostable archaeal proteins like AF_1460, researchers should consider performing structural experiments across temperature ranges to capture potential temperature-dependent conformational changes. Integration of multiple structural techniques provides the most comprehensive characterization.

What genetic approaches can elucidate AF_1460 function in vivo?

  • Heterologous Expression Studies:

    • Express AF_1460 in model organisms (Thermococcus, Sulfolobus) with genetic tools

    • Assess phenotypic changes and compensatory effects

  • CRISPR-Cas9 Based Approaches:

    • Develop thermostable CRISPR systems for A. fulgidus

    • Generate AF_1460 knockouts or point mutations

    • Characterize growth, stress resistance, and metabolic phenotypes

  • Complementation Studies:

    • Identify potential homologs in genetically tractable organisms

    • Attempt functional complementation with AF_1460

  • Transcriptomic Analysis:

    • Compare expression profiles between normal and stress conditions

    • Identify co-regulated genes for functional inference

When designing genetic experiments, researchers should carefully consider the native growth conditions of A. fulgidus (anaerobic, thermophilic, sulfur-reducing) and the technical limitations of genetic manipulation in extremophiles.

How does AF_1460 relate to archaeal-specific cellular processes?

AF_1460's conservation across archaea but lack of clear bacterial or eukaryotic homologs suggests potential involvement in archaeal-specific processes:

  • DNA Replication and Repair Systems:

    • Investigate potential interactions with archaeal-specific DNA replication machinery

    • Assess DNA binding capabilities through EMSA or related techniques

    • Test involvement in repair of thermally-induced DNA damage

  • Archaeal-Specific Membrane Processes:

    • Analyze potential membrane association through fractionation studies

    • Investigate interactions with archaeal lipids

    • Test localization using fluorescent fusion proteins

  • Stress Response Mechanisms:

    • Compare expression levels under various stress conditions

    • Test phenotypic consequences of AF_1460 manipulation under stress

    • Investigate potential roles in thermotolerance or oxidative stress response

  • Metabolic Adaptations:

    • Explore potential roles in archaeal-specific metabolic pathways

    • Focus on sulfur metabolism, which is significant in A. fulgidus biology

Research into archaeal-specific processes should consider the evolutionary position of archaea and the potential for unique biological mechanisms not present in bacteria or eukaryotes.

How can antibodies against AF_1460 be developed and validated?

Development of antibodies against AF_1460 provides valuable research tools for localization, interaction, and functional studies:

  • Immunogen Design:

    • Use full-length recombinant protein for polyclonal antibody production

    • Select antigenic peptides (12-20 amino acids) for monoclonal development

    • Consider carrier protein conjugation to enhance immunogenicity

  • Antibody Production Methods:

    • Polyclonal antibody generation in rabbits or other suitable hosts

    • Monoclonal antibody development using hybridoma technology

    • Recombinant antibody production using phage display

  • Validation Strategies:

    • Western blot against recombinant protein and native extracts

    • Immunoprecipitation efficiency testing

    • Pre-absorption controls with recombinant protein

    • Cross-reactivity testing against related archaeal species

Researchers should consider the thermostable nature of archaeal proteins when designing sample preparation protocols for antibody applications. Native A. fulgidus proteins may require specific denaturation conditions for efficient antibody recognition in Western blots.

What methodological considerations are important when studying thermostable proteins like AF_1460?

Working with proteins from hyperthermophiles presents unique methodological challenges:

Table 5. Methodological Considerations for Thermostable Proteins

AspectChallengeMethodological Approach
Enzyme assaysStandard assay temperatures may not reflect native activityConduct assays at elevated temperatures (65-85°C); use thermostable assay components
Protein stabilityProtein may be overly rigid at room temperatureTest functionality across temperature range; include activity controls
Structural studiesCrystal packing may differ from mesophilic proteinsConsider crystallization at elevated temperatures; use molecular dynamics simulations to model flexibility
Interaction studiesNative interactions may be temperature-dependentPerform binding assays at various temperatures; consider on-rate/off-rate analyses
Buffer selectionTraditional buffers may have different properties at high temperaturesUse buffers with minimal temperature coefficients; consider pH shifts with temperature

When studying thermostable proteins like AF_1460, researchers should carefully control temperature conditions during all experimental procedures and consider how the protein's properties might change across temperature ranges relevant to its native environment.

How can high-throughput methodologies be applied to AF_1460 functional screening?

High-throughput approaches accelerate functional discovery for uncharacterized proteins like AF_1460:

  • Microarray-Based Methods:

    • Protein microarrays for interaction partner screening

    • Metabolite arrays for substrate identification

    • DNA/RNA arrays for nucleic acid binding assessment

  • Library Screening Approaches:

    • Phage display for peptide ligand identification

    • Small molecule libraries for activity modulation

    • Ribosome display for RNA aptamer selection

  • Automated Structural Biology:

    • High-throughput crystallization condition screening

    • Fragment-based screening for binding site identification

    • Thermal shift assays for stability and ligand binding

  • Computational Screening:

    • Virtual ligand docking campaigns

    • Molecular dynamics simulations under varying conditions

    • Machine learning predictions based on similar proteins

When implementing high-throughput approaches, researchers should design appropriate controls and validation methods to distinguish true positive results from experimental artifacts. Secondary validation using orthogonal techniques is essential for conclusive identification of functional properties.

What are the key challenges in studying uncharacterized archaeal proteins like AF_1460?

Research on uncharacterized archaeal proteins faces several fundamental challenges:

  • Limited genetic manipulation tools for native archaeal systems

  • Difficulty in replicating extreme growth conditions in laboratory settings

  • Lack of functional homology with well-characterized bacterial or eukaryotic proteins

  • Technical challenges in expressing and handling thermostable proteins

  • Uncertainty about physiological relevance of in vitro observations

Despite these challenges, proteins like AF_1460 offer unique opportunities to discover novel biological mechanisms and expand our understanding of archaeal biology. The conservation of AF_1460 across archaeal species suggests functional importance that merits continued investigation.

What emerging technologies show promise for advancing AF_1460 research?

Several cutting-edge methodologies hold particular promise for uncharacterized archaeal proteins:

  • AlphaFold and Related Structural Prediction Tools:

    • Accurate structural predictions can guide functional hypotheses

    • Integration with evolutionary data enhances functional insights

  • Single-Cell Technologies for Extremophiles:

    • Single-cell transcriptomics under various conditions

    • Microfluidic cultivation of extremophiles

    • Single-cell metabolomics for functional insights

  • Archaeal-Specific Genetic Tools:

    • Development of thermostable CRISPR systems

    • Archaeal-specific expression vectors and reporters

    • In vivo imaging techniques for extremophiles

  • Multi-Omics Integration:

    • Combined proteomics, transcriptomics, and metabolomics approaches

    • Network-based functional prediction algorithms

    • Machine learning integration of heterogeneous data types

These emerging technologies, coupled with traditional biochemical and structural approaches, provide a comprehensive toolkit for deciphering the function of challenging proteins like AF_1460.

How does understanding AF_1460 contribute to broader knowledge of archaeal biology?

The characterization of conserved uncharacterized proteins like AF_1460 has implications beyond the specific protein:

  • Provides insights into archaeal-specific biological processes

  • Enhances understanding of protein adaptation to extreme environments

  • May reveal novel enzymatic activities or regulatory mechanisms

  • Contributes to evolutionary understanding of archaea as a domain of life

  • Potentially identifies new biotechnological applications for thermostable proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.