Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1487 (AF_1487)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
AF_1487; Uncharacterized protein AF_1487
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1487
Target Protein Sequence
MSDMRRLMILFLLVGLAVVLSGCATLSVHSKVNKDGSVESYKLVINTSSFVYGLLAEGAK KEGYESLRESFLSEIPEEMRDKVSYDEVWSGDQVSIIIEARDYVPADDDKVKIRKENGFL IYEDLSFASENNQTSSNELGNALLSSFSLHYYLEMPGKIVESNANVVKDNKAEWHLTGAS AFNTRIYAKSEVPGIPGFEAALAIVGLLAAGLLFGRVKG
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1487

STRING: 224325.AF1487

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant for research?

Archaeoglobus fulgidus is a hyperthermophilic archaeon belonging to the euryarchaeal branch of the Archaea domain. It is an anaerobic sulfate reducer capable of growing at temperatures up to 95°C, making it one of the most heat-tolerant organisms known. This extremophile was first isolated from marine hydrothermal vents and has since become a model organism for studying life under extreme conditions . The significance of A. fulgidus for research stems from its exceptional thermostability, which provides insights into molecular adaptations to extreme environments.

The genome of A. fulgidus was among the first archaeal genomes to be fully sequenced, facilitating comprehensive genomic analyses. This has enabled researchers to identify numerous uncharacterized proteins, including AF_1487, which present opportunities to discover novel protein functions that may be unique to this organism or shared among extremophiles. Additionally, research on A. fulgidus has revealed distinctive DNA repair mechanisms, such as the β-elimination mechanism for base excision repair (BER) following uracil removal, which differs from the hydrolytic mechanism commonly found in most eukaryotes and bacteria .

From an evolutionary perspective, studying A. fulgidus contributes to our understanding of early life forms and the divergence of the three domains of life. The heat-stable proteins and enzymes from this organism also have significant biotechnological potential, particularly for industrial processes requiring high-temperature conditions.

What approaches can be used to express recombinant Archaeoglobus fulgidus proteins?

The expression of recombinant proteins from hyperthermophilic archaea like A. fulgidus requires careful consideration of expression systems and conditions to ensure proper folding and activity. Several methodological approaches have proven successful for A. fulgidus proteins:

  • Gene Amplification and Cloning: The target gene (AF_1487) can be amplified from genomic A. fulgidus DNA using PCR with specific primers containing appropriate restriction sites. For example, successful amplification has been achieved using primers with XhoI and KpnI restriction sites and Platinum Taq high-fidelity DNA polymerase .

  • Expression Vector Selection: Vectors with inducible promoters, such as the arabinose-inducible pBAD/HisA system, have been successfully used for A. fulgidus proteins . These allow controlled expression that can be optimized to minimize inclusion body formation.

  • Expression Host Optimization: While E. coli remains the most common host for recombinant protein expression, specific strains like BL21(DE3), Rosetta, or ArcticExpress may improve expression of archaeal proteins by addressing issues such as codon bias or low-temperature folding.

Table 1. Comparison of Expression Systems for A. fulgidus Proteins

Expression SystemAdvantagesLimitationsSuitable for AF_1487
E. coli pBAD/HisAArabinose-inducible, tight regulation, His-tag for purificationPotential codon bias issuesYes, demonstrated success with other A. fulgidus proteins
E. coli pET systemHigh expression levels, T7 promoterMay lead to inclusion bodiesPotentially, with optimization
Cold-adapted E. coli strainsBetter folding at lower temperaturesLower expression yieldsWorth testing for thermophilic proteins
Yeast expression systemsEukaryotic folding machineryMore complex cultivationFor proteins challenging in E. coli
Cell-free systemsAvoids toxicity issuesHigher cost, lower yieldFor toxic proteins
  • Expression Conditions: For thermophilic proteins, lower induction temperatures (15-25°C) often improve solubility by slowing protein synthesis. The addition of osmolytes (e.g., betaine, sorbitol) or co-expression of chaperones can further enhance proper folding.

  • Purification Strategy: Affinity tags (His-tag, GST) facilitate purification while considering the thermostability of the target protein. Heat treatment (60-80°C) can be used as an initial purification step, exploiting the thermostability of A. fulgidus proteins to denature E. coli host proteins .

What are the common challenges in working with proteins from hyperthermophilic organisms?

Working with proteins from hyperthermophilic organisms like A. fulgidus presents several distinct challenges that require methodological adaptations:

  • Protein Folding and Solubility: Hyperthermophilic proteins have evolved to function optimally at high temperatures and may not fold properly at lower temperatures, leading to aggregation and inclusion body formation. This can be addressed by lowering the induction temperature, reducing inducer concentration, or co-expressing molecular chaperones.

  • Activity Assessment Conditions: The optimal activity conditions for hyperthermophilic proteins typically differ significantly from standard laboratory conditions. These proteins require high temperatures (60-95°C for A. fulgidus proteins), specific pH ranges, or high salt concentrations for proper activity assessment, necessitating specialized equipment and buffers.

  • Protein Stability During Handling: While hyperthermophilic proteins are exceptionally stable at high temperatures, they may exhibit instability during purification and storage at lower temperatures. Buffer compositions often need to be optimized with stabilizing agents like glycerol, trehalose, or specific ions to enhance stability at room temperature.

  • Structural Analysis Challenges: Conventional structural biology techniques may require adaptation for thermophilic proteins. For example, crystallization conditions may need to incorporate higher salt concentrations or include specific stabilizing additives.

  • Functional Annotation: The functional annotation of uncharacterized proteins like AF_1487 is complicated by the unique adaptations of hyperthermophiles. Conventional sequence homology-based approaches may be less effective due to the specialized nature of these proteins, necessitating a combination of computational and experimental methods.

How can one verify the successful expression of a recombinant Archaeoglobus fulgidus protein?

Verifying the successful expression of a recombinant A. fulgidus protein involves multiple complementary approaches:

  • SDS-PAGE Analysis: This technique allows visualization of protein expression by comparing lysates before and after induction. For A. fulgidus proteins, SDS-PAGE has been effectively used with 12% polyacrylamide gels and appropriate molecular weight markers .

  • Western Blotting: This provides more specific verification, particularly when expression levels are low. For A. fulgidus proteins, Western blotting has been performed using nitrocellulose membranes, antibodies against the target protein or fusion tags, and visualization systems such as horseradish peroxidase-based detection .

  • Mass Spectrometry: This offers definitive confirmation of protein identity through techniques such as MALDI-TOF or LC-MS/MS, providing both molecular weight confirmation and peptide sequence information.

  • Functional Assays: If the protein's function is known or predicted, activity assays can provide indirect verification of successful expression and proper folding.

  • Thermal Shift Assays: These can be particularly informative for hyperthermophilic proteins, which typically display high melting temperatures distinguishable from most E. coli proteins.

Table 2. Verification Methods for Recombinant A. fulgidus Proteins

Verification MethodInformation ProvidedTechnical Considerations for AF_1487
SDS-PAGEMolecular weight, expression levelUse 12% gels, Precision protein standards as markers
Western blottingSpecific detection, expression levelCan use antibodies against fusion tags if protein-specific antibodies unavailable
ImmunodepletionAntibody specificity, protein identityRequires specific antibodies against AF_1487
Mass spectrometryDefinitive identification, sequence coverageTryptic digestion followed by MS/MS analysis
Thermal stabilityProper folding, thermostabilityDifferential scanning fluorimetry at elevated temperatures

For A. fulgidus proteins, immunodepletion experiments have been successfully used to confirm the identity and specificity of target proteins. In these experiments, cell extracts are treated with antibodies raised against the purified recombinant protein to remove the native protein, followed by activity assays to confirm depletion of the specific activity .

What are the appropriate storage conditions for recombinant proteins from hyperthermophilic archaea?

The storage of recombinant proteins from hyperthermophilic archaea like A. fulgidus requires special consideration to maintain protein stability and activity:

  • Buffer Composition: While hyperthermophilic proteins are inherently stable at high temperatures, they may be less stable at lower storage temperatures. Optimal storage buffers typically include stabilizing agents such as glycerol (20-50%), which prevents freezing damage and maintains protein solubility. Additionally, reducing agents like DTT or β-mercaptoethanol (1-5 mM) may be necessary to prevent oxidation of cysteine residues.

  • pH Optimization: The intracellular pH of A. fulgidus is around 6.5-7.0, and maintaining recombinant proteins at a similar pH often improves stability. Buffer systems such as HEPES, phosphate, or Tris at concentrations of 20-50 mM are commonly used.

  • Storage Temperature: For short-term storage (days to weeks), 4°C may be suitable when supplemented with appropriate stabilizers. For medium-term storage, -20°C with adequate cryoprotectants like glycerol is common. For long-term storage, -80°C or liquid nitrogen storage after flash-freezing aliquots is preferred.

  • Avoiding Freeze-Thaw Cycles: Repeated freeze-thaw cycles can lead to protein denaturation and aggregation. Dividing purified protein into single-use aliquots before freezing is a standard practice.

  • Lyophilization: For some proteins, lyophilization (freeze-drying) with appropriate lyoprotectants such as trehalose or sucrose provides an alternative for long-term storage.

Table 3. Optimized Storage Conditions for A. fulgidus Recombinant Proteins

Storage DurationTemperatureRecommended Buffer ComponentsAdditional Considerations
Short-term (days)4°C50 mM HEPES/Tris pH 7.0, 150-300 mM NaClAdd 0.02% sodium azide to prevent contamination
Medium-term (weeks)-20°CAbove buffer + 20-30% glycerol, 1-5 mM DTTEnsure complete mixing before freezing
Long-term (months/years)-80°CAbove buffer + 30-50% glycerolFlash freeze in small aliquots
AlternativeLyophilized10-20 mM phosphate buffer + 5% trehaloseStore desiccated at -20°C

Testing protein activity after different storage periods and conditions is essential to determine the optimal approach for specific proteins like AF_1487.

What experimental design approaches are most suitable for characterizing the function of AF_1487?

Characterizing the function of an uncharacterized protein like AF_1487 requires a strategic experimental design approach that leverages both computational predictions and diverse experimental methodologies:

  • Bioinformatic Analysis: Before experimental work, comprehensive bioinformatic analysis provides essential guidance. This includes sequence homology searches, protein domain identification, structural predictions, and phylogenetic analysis to generate initial functional hypotheses.

  • Design of Experiments (DOE) Methodology: The DOE approach is particularly valuable for optimizing multiple experimental parameters simultaneously when characterizing novel proteins. This statistical approach efficiently determines optimal conditions for activity assays by systematically varying factors such as temperature, pH, salt concentration, and potential cofactors.

Table 4. DOE Factors for AF_1487 Functional Characterization

FactorLevelsRationaleResponse Variables
Temperature25°C, 45°C, 65°C, 85°CAssess temperature dependenceActivity, stability
pH5.0, 6.0, 7.0, 8.0Identify pH optimumActivity, binding affinity
Salt concentration50mM, 150mM, 300mM, 500mMTest ionic strength effectsSolubility, activity
Potential cofactorsNone, Mg²⁺, Mn²⁺, ATP, ADPIdentify cofactor requirementsActivity enhancement
Potential substratesDNA, RNA, proteins, metabolitesIdentify substrate preferenceProduct formation
  • Protein-Protein Interaction Studies: Co-immunoprecipitation experiments can identify binding partners of AF_1487. Similar techniques have been successfully applied to study protein interactions in other systems . Pull-down assays using recombinant AF_1487 as bait can capture interacting proteins from A. fulgidus lysates, with interactors identified by mass spectrometry.

  • Genetic Approaches: If feasible, gene knockout or knockdown studies in A. fulgidus can provide insights into the physiological role of AF_1487. The phenotypic consequences of AF_1487 depletion would provide valuable clues about its function.

  • Heterologous Expression: Expression of AF_1487 in E. coli strains deficient in specific pathways, followed by complementation testing, may identify the functional category of the protein.

A systematic workflow would progress from computational predictions to in vitro biochemical assays, followed by in vivo functional studies, with each stage informing the design of subsequent experiments.

How can one assess the potential involvement of AF_1487 in DNA repair pathways?

Assessing the potential involvement of AF_1487 in DNA repair pathways requires a multi-faceted approach, especially given that A. fulgidus is known to possess distinctive DNA repair mechanisms :

  • Sequence and Structural Analysis: Identify potential DNA-binding domains or motifs characteristic of DNA repair proteins using tools such as DNABindR or BindN. Structural modeling may reveal structural similarities to known DNA repair proteins even in the absence of significant sequence homology.

  • DNA Binding Assays: Electrophoretic mobility shift assays (EMSAs) using different DNA substrates can reveal binding preferences. For A. fulgidus proteins involved in uracil repair, radioactively labeled oligonucleotides containing specific lesions have been used to assess binding and catalytic activities .

  • Enzymatic Activity Assays: For potential glycosylase activity (similar to the UDG in A. fulgidus ), assays using radiolabeled DNA substrates containing specific lesions can be performed. These assays should be conducted at physiologically relevant temperatures for A. fulgidus (around 80-85°C).

  • Comparative Analysis with Known A. fulgidus DNA Repair Proteins: The family 4 type uracil-DNA glycosylase (UDG) has been identified as the principal enzyme for uracil excision in A. fulgidus . Comparing the properties of AF_1487 with this characterized enzyme could provide functional insights.

Table 5. Comparison of DNA Repair Pathway Assessment Methods

Assessment MethodApplication to AF_1487ControlsExpected Outcomes if Involved in DNA Repair
DNA binding assaysTest binding to damaged DNA substratesKnown A. fulgidus UDG Preferential binding to specific DNA lesions
Glycosylase activity assayMeasure release of damaged basesE. coli Ung as positive control Release of specific damaged bases
AP site processingTest β-elimination or hydrolytic mechanismNth or Fpg proteins as controls Generation of specific DNA strand breaks
Immunodepletion effectsDeplete AF_1487 from cell extractsAnti-AF_1487 antibodiesReduction in specific repair activities
Complementation testsExpress in E. coli repair mutantsEmpty vector controlsRestoration of DNA damage resistance
  • Immunodepletion Experiments: If AF_1487 is involved in DNA repair, depleting it from cell extracts using specific antibodies should reduce the corresponding repair activity. This approach has been successfully used to confirm the role of UDG in A. fulgidus .

  • Response to DNA Damaging Agents: Examining changes in AF_1487 expression or activity in response to DNA damaging agents (UV, oxidative stress, alkylating agents) could provide evidence for its involvement in damage response pathways.

What techniques can be used to determine the three-dimensional structure of AF_1487?

Determining the three-dimensional structure of AF_1487 requires selecting appropriate techniques based on the protein's properties:

Table 6. Structural Determination Techniques for AF_1487

TechniqueResolution RangeSample RequirementsAdvantages for AF_1487Limitations
X-ray crystallography1-3ÅCrystals, mg quantitiesHigh resolution, works well with thermostable proteinsRequires crystallization
NMR spectroscopy2-5ÅSoluble protein, isotope labelingSolution structure, dynamics informationSize limitation (~30kDa)
Cryo-EM2.5-4Åμg quantities, vitrified sampleWorks with heterogeneous samplesChallenging for small proteins
SAXS10-20ÅSoluble protein in solutionLow sample requirements, solution stateLow resolution
AlphaFold2 predictionVariableSequence onlyRapid, improving accuracyPrediction, not experimental
  • Integrative Structural Biology: Combining multiple experimental techniques with computational modeling is particularly effective. For instance, the structural alignment of human IL-33 with its receptor ST2 has provided insights into functional domains and interaction surfaces . Similar approaches could be applied to AF_1487.

  • Computational Structure Prediction: Tools like AlphaFold2 have revolutionized protein structure prediction. While not a substitute for experimental determination, these predictions can guide experimental design and provide initial structural models.

A practical workflow for AF_1487 structure determination might begin with computational predictions to guide construct design, followed by parallel attempts at crystallization and solution-based methods.

How can researchers address the challenges of protein stability when working with recombinant hyperthermophilic proteins at non-physiological temperatures?

Addressing protein stability challenges when working with recombinant hyperthermophilic proteins like AF_1487 at non-physiological temperatures requires systematic optimization:

  • Buffer Composition Optimization: Hyperthermophilic proteins often contain a higher proportion of charged residues that form stabilizing salt bridges at physiological temperatures. Buffer optimization should include screening of:

    • Salt type and concentration (typically 300-500 mM NaCl or KCl)

    • pH ranges to identify optimal stability conditions

    • Addition of osmolytes like glycerol (10-20%), trehalose, or sucrose

    • Reducing agents such as DTT or TCEP

    • Specific ions that may be required for structural integrity

  • Protein Engineering Approaches: These can enhance stability at lower temperatures while maintaining native structure:

    • Surface engineering to increase charged or polar residues

    • Introduction of disulfide bonds at strategic positions

    • Design of stabilizing mutations

    • Creation of truncated constructs that remove flexible regions

Table 7. Stability Enhancement Strategies for Hyperthermophilic Proteins

StrategySpecific ApproachImplementation for AF_1487Expected Outcome
Buffer additives20-30% glycerol, 300mM NaClAdd during purification and storagePrevents aggregation, maintains solubility
Cofactor additionMg²⁺, ATP/ADPScreening different cofactors Stabilizes native conformation
Temperature managementPurification at 40-50°CGradually reduce temperatureMaintains native fold during processing
Protein engineeringSurface residue modificationComputational design followed by mutagenesisImproved stability at ambient temperature
Molecular chaperonesCo-expression with GroEL/ESClone chaperones into expression systemAssists proper folding during expression
  • Temperature Management: Working at intermediate temperatures when possible can bridge the gap between optimal growth temperatures (80-85°C for A. fulgidus) and standard laboratory temperatures. The finding that repair product formation in A. fulgidus extracts is stimulated similarly by ATP and ADP suggests that ADP might be more important in vivo due to its higher heat stability . Similar considerations may apply to AF_1487 stability.

  • Rapid Characterization Techniques: These minimize the time proteins spend under potentially destabilizing conditions:

    • Fast protein liquid chromatography (FPLC) systems for rapid purification

    • Thermofluor assays to quickly identify stabilizing buffer conditions

    • Activity assays designed to work at elevated temperatures

  • Stabilization through Complex Formation: If AF_1487 forms complexes with other proteins or ligands, including these binding partners may enhance stability at lower temperatures.

What bioinformatic approaches can help predict the function of uncharacterized proteins like AF_1487?

Predicting the function of uncharacterized proteins like AF_1487 requires sophisticated bioinformatic approaches that integrate multiple types of evidence:

  • Sequence-Based Analysis:

    • Homology searches using tools like BLAST, PSI-BLAST, or HHpred

    • Domain identification using InterPro, Pfam, or CDD

    • Motif analysis using MEME, PROSITE, or similar tools

    • Multiple sequence alignment with related proteins

    • Transmembrane topology and signal peptide prediction

  • Structure-Based Prediction:

    • Structural modeling using AlphaFold2, I-TASSER, or Robetta

    • Structural alignment against databases like SCOP or CATH

    • Active site prediction using tools like COACH or 3DLigandSite

    • Electrostatic surface analysis

    • Molecular docking simulations

Table 8. Bioinformatic Tools for Functional Prediction of AF_1487

Analysis TypeRecommended ToolsApplication to AF_1487Output Interpretation
Sequence homologyBLAST, HHpredIdentify distant homologsE-values < 1e-3 suggest homology
Domain analysisInterPro, CDDIdentify functional domainsDomain architecture suggests function
Structural predictionAlphaFold2, I-TASSERGenerate 3D modelsStructural similarity to known proteins
Binding site predictionCOACH, 3DLigandSiteIdentify potential active sitesConserved residue clusters suggest function
Genomic contextSTRING, ProOpDBIdentify functional associationsGene neighborhood and co-occurrence patterns
Phylogenetic analysisMEGA, PhyMLEvolutionary relationshipsClustering with characterized proteins
  • Genomic Context Analysis:

    • Gene neighborhood analysis to identify consistently co-located genes

    • Gene fusion events that may indicate functional relationships

    • Phylogenetic profiling to identify co-evolving proteins

    • Expression pattern correlations from transcriptomic data, if available

  • Network-Based Approaches:

    • Protein-protein interaction predictions using tools like STRING

    • Metabolic pathway mapping using KEGG or BioCyc

    • Functional networks based on co-expression or shared phenotypes

  • Machine Learning Approaches:

    • Deep learning models trained on sequence, structure, and functional data

    • Ensemble methods combining multiple prediction algorithms

    • Transfer learning from well-characterized protein families

The existing knowledge about DNA repair mechanisms in A. fulgidus, particularly the characterization of the uracil-DNA glycosylase and its β-elimination mechanism for incision of abasic sites , provides valuable context for the functional prediction of other proteins in this organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.