Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1562 (AF_1562)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
AF_1562; Uncharacterized protein AF_1562
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1562
Target Protein Sequence
MVKMDRGRKVPEEQIIYADILYYGGLIGIIFMAITFAIYVSGTLPSLVKPEELTELWTHD THYYLEETGLPTGWGWINYVTYGDVLNFVALAFLAMITIICYLAIIPVLLKKKDIIYTIL AIAEVIILLLAASGLLQAGH
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1562

STRING: 224325.AF1562

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are commonly used for recombinant production of AF_1562?

    The most established expression system for AF_1562 is E. coli, which has been successfully used to produce full-length recombinant protein with an N-terminal His tag. The protein is typically expressed under standard conditions using IPTG induction. While E. coli provides good yields, researchers should note that as a membrane protein from a hyperthermophilic archaeon, AF_1562 may require optimization of expression conditions to maintain proper folding and stability .

  • What purification methods are most effective for recombinant AF_1562?

    Purification of recombinant His-tagged AF_1562 is typically performed using immobilized metal affinity chromatography (IMAC). The optimal purification protocol includes:

    1. Cell lysis under native conditions

    2. Binding to Ni-NTA or similar resin

    3. Washing with buffer containing low imidazole concentrations (20-50 mM)

    4. Elution with higher imidazole concentration (200-400 mM)

    For membrane proteins like AF_1562, the addition of appropriate detergents during purification is critical to maintain protein solubility and native conformation .

Advanced Research Methodologies

  • What structural characterization techniques are most suitable for AF_1562 as a membrane protein?

    Since AF_1562 appears to be a membrane protein based on its amino acid sequence, the following structural characterization techniques are recommended:

    • Cryo-electron microscopy (cryo-EM): Particularly effective for membrane proteins that may be difficult to crystallize

    • NMR spectroscopy: For dynamic regions and protein-lipid interactions

    • Circular dichroism (CD): To assess secondary structure content

    • Small-angle X-ray scattering (SAXS): For low-resolution structural information in solution

    These methods should be complemented with computational prediction tools specific to membrane proteins. For instance, approaches similar to those used for other A. fulgidus membrane proteins like Af1503 can be adapted .

  • How can researchers determine the localization and topology of AF_1562 in Archaeoglobus fulgidus?

    To determine the subcellular localization and membrane topology of AF_1562:

    1. Immunolocalization: Using antibodies against the recombinant protein in fixed A. fulgidus cells

    2. GFP fusion constructs: For heterologous expression systems

    3. Protease accessibility assays: To map exposed regions of the protein

    4. Site-directed cysteine labeling: To determine which regions are accessible from which side of the membrane

    5. Membrane fractionation: To confirm membrane association

    These approaches should be performed under conditions mimicking the native hyperthermophilic environment (optimal growth temperature of 78-85°C) to maintain physiological relevance .

  • What are the optimal conditions for functional characterization of AF_1562 considering its origin from a hyperthermophilic archaeon?

    For functional characterization of AF_1562:

    ParameterRecommended ConditionRationale
    Temperature75-85°CMatches A. fulgidus optimal growth temperature
    pH6.8-7.5Optimal pH range for A. fulgidus physiology
    Salt concentration0.5-1.0 M NaClMimics high-salt environment of native organism
    Buffer systemHEPES or phosphateStability at high temperatures
    Reducing agentsInclude 1-5 mM DTTMaintains protein stability

    A. fulgidus proteins typically show maximum activity at temperatures around 80-85°C, and assays should be designed to accommodate these extreme conditions. Stability tests similar to those performed for the A. fulgidus ferric reductase can serve as a model .

  • What bioinformatic approaches can help predict the function of the uncharacterized AF_1562 protein?

    A comprehensive bioinformatic approach for predicting AF_1562 function should include:

    1. Sequence-based analyses:

      • Profile hidden Markov models to detect distant homologs

      • Analysis of conserved domains and motifs

      • Phylogenetic profiling to identify co-evolved genes

    2. Structural prediction and analysis:

      • AlphaFold2 or RoseTTAFold for structure prediction

      • Structural similarity searches against PDB

      • Binding pocket prediction and analysis

    3. Genomic context analysis:

      • Analysis of operonic structure and neighboring genes

      • Comparative genomics across Archaeoglobus species

      • Gene co-expression networks if transcriptomic data is available

    This approach has proven successful for other uncharacterized proteins in A. fulgidus such as AF_1577 .

Experimental Design Questions

  • What experimental approaches are recommended to investigate potential involvement of AF_1562 in the heat shock response of A. fulgidus?

    Given that A. fulgidus has a well-characterized heat shock response system, investigating AF_1562's potential involvement would include:

    1. Transcriptomic analysis: Measure AF_1562 expression levels before and after heat shock (shifting from 78°C to 89°C) using RT-qPCR or RNA-seq

    2. Promoter analysis: Examine the upstream region of AF_1562 for heat shock regulatory elements, particularly for the palindromic motif CTAAC-N5-GTTAG associated with HSR1 regulation

    3. Protein-DNA interaction studies: Perform EMSAs and DNase I footprinting with the HSR1 protein and the AF_1562 promoter region

    4. Gene knockout/knockdown: Assess the impact on heat shock response in deletion mutants

    5. Protein expression and stability: Compare protein levels and stability at normal growth temperature versus heat shock conditions

    This experimental approach is modeled after successful studies of heat shock response in A. fulgidus that identified key regulatory elements and proteins .

  • How can researchers investigate potential protein-protein interactions involving AF_1562?

    To investigate protein-protein interactions of AF_1562:

    1. Co-immunoprecipitation with antibodies against AF_1562 from A. fulgidus cell lysates, followed by mass spectrometry to identify binding partners

    2. Bacterial/yeast two-hybrid assays adapted for high-temperature proteins

    3. Surface plasmon resonance (SPR) or microscale thermophoresis (MST) for direct binding assays with candidate interacting proteins

    4. Crosslinking mass spectrometry (XL-MS) to capture transient interactions

    5. Proximity labeling approaches such as BioID or APEX2, adapted for hyperthermophilic conditions

    For membrane proteins like AF_1562, detergent solubilization or membrane mimetics (nanodiscs, liposomes) may be necessary to maintain native conformation during interaction studies .

  • What approaches can be used to investigate the potential role of AF_1562 in membrane transport or signaling?

    Based on the membrane-associated nature of AF_1562, the following experimental approaches are recommended:

    1. Reconstitution in liposomes to assess transport activity:

      • Purify recombinant AF_1562

      • Reconstitute in liposomes with various lipid compositions

      • Perform transport assays with radiolabeled or fluorescent substrates

    2. Patch-clamp electrophysiology in heterologous expression systems

    3. Membrane potential measurements in native cells or proteoliposomes

    4. Binding assays with potential ligands or substrates

    5. Structural studies focusing on conformational changes upon substrate binding

    These approaches have been successful in characterizing other membrane proteins from hyperthermophilic archaea, and would need to be performed under temperature and ionic conditions relevant to A. fulgidus .

Comparative Research Questions

  • How does AF_1562 compare to other uncharacterized membrane proteins in Archaeoglobus fulgidus?

    A. fulgidus contains several uncharacterized membrane proteins that can be compared with AF_1562:

    ProteinLength (aa)Predicted TM domainsSimilar features to AF_1562Key differences
    AF_15601323-4Similar hydrophobicity patternLower glycine content
    AF_15771463-4Membrane associationDifferent charged residue distribution
    AF_15821513-5Multiple TM domainsContains potential metal-binding motif

    Comparative analysis suggests these proteins may represent a family of membrane proteins with potentially related but distinct functions in A. fulgidus. Structural modeling using AlphaFold2 has been applied to AF_1577 and could be extended to AF_1562 for structural comparison .

  • What can be learned from comparing AF_1562 with its homologs in other archaeal species?

    Comparative analysis of AF_1562 with homologs in other archaeal species can provide insights into:

    1. Conservation patterns: Identifying highly conserved residues that may be functionally important

    2. Evolutionary history: Understanding when this protein family emerged and how it diversified

    3. Functional hints: Correlation with specific metabolic capabilities or environmental adaptations

    4. Domain architecture variations: Identifying species-specific additions or deletions

    BLAST and HMM-based searches should be performed against archaeal genomes, with special attention to other hyperthermophiles and methanogens. Phylogenetic analysis can then correlate protein features with taxonomic and metabolic diversity across the archaeal domain .

  • How might AF_1562 contribute to the extremophilic properties of Archaeoglobus fulgidus?

    As a hyperthermophilic sulfate-reducing archaeon that grows optimally at 83°C, A. fulgidus requires specialized adaptations. AF_1562 may contribute to extremophilic properties through:

    1. Membrane stability: The hydrophobic residue patterns in AF_1562 may contribute to maintaining membrane integrity at high temperatures

    2. Stress response: Potential involvement in heat shock or other stress responses, similar to other characterized proteins in A. fulgidus

    3. Ion homeostasis: Possible role in maintaining ion gradients under extreme conditions

    4. Metabolic adaptation: Potential involvement in sulfate reduction or other unique metabolic pathways of A. fulgidus

    Experimental approaches should compare AF_1562 expression and function under different stress conditions, following methodologies established for the heat shock response studies in A. fulgidus .

Technical Considerations

  • What are the critical considerations for storing and handling recombinant AF_1562 to maintain its stability and activity?

    For optimal storage and handling of recombinant AF_1562:

    1. Storage recommendations:

      • Store lyophilized protein at -20°C/-80°C

      • After reconstitution, store working aliquots at 4°C for up to one week

      • For long-term storage, add 30-50% glycerol and store at -20°C/-80°C

      • Avoid repeated freeze-thaw cycles

    2. Reconstitution protocol:

      • Briefly centrifuge vial before opening

      • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

      • For membrane proteins, consider adding appropriate detergents

    3. Buffer considerations:

      • Tris/PBS-based buffer, pH 8.0, with 6% trehalose helps maintain stability

      • For functional studies, buffers should be compatible with high temperatures

    These recommendations are based on established protocols for recombinant AF_1562 and similar proteins from hyperthermophilic organisms .

  • What are the specific challenges in designing assays to determine the enzymatic activity of uncharacterized proteins like AF_1562?

    Designing activity assays for uncharacterized proteins presents several challenges:

    1. Substrate identification: Without functional annotation, potential substrates must be tested empirically or predicted bioinformatically

    2. Assay conditions: Optimization requires testing multiple conditions:

      • Temperature range (60-95°C for A. fulgidus proteins)

      • pH range (5.5-8.5)

      • Salt concentration (0.1-2.0 M)

      • Cofactor requirements (metal ions, coenzymes)

    3. Detection methods: Various detection approaches may be needed:

      • Spectrophotometric assays

      • Coupled enzyme assays

      • Mass spectrometry-based activity assays

      • Radiolabeled substrate tracking

    4. Technical limitations: Equipment must be suitable for high-temperature assays, potentially requiring specialized instrumentation

    A systematic approach is recommended, starting with bioinformatic predictions and testing a panel of standard substrates relevant to membrane proteins (e.g., ion transport, small molecule transport) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.