Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1573 (AF_1573)

What is Archaeoglobus fulgidus and why is AF_1573 significant for research?

Archaeoglobus fulgidus is a hyperthermophilic, sulfate-reducing archaeon originally isolated from marine hydrothermal systems and deep oil fields. It belongs to the Archaeoglobi class within the Euryarchaeota phylum . The organism is significant because:

• It grows at extremely high temperatures (optimal at 85°C)

• It represents an evolutionary interesting position between methanogens and sulfate reducers

• Its proteins exhibit exceptional thermostability, making them valuable for biotechnological applications

AF_1573 (UniProt accession: O28699) is an uncharacterized protein of 131 amino acids with no assigned function . Studying such proteins is crucial for:

• Completing our understanding of archaeal metabolic networks

• Discovering novel enzymatic activities adapted to extreme conditions

• Exploring protein structure-function relationships in thermophiles

• Identifying potential biocatalysts for industrial applications

What are the known structural characteristics of AF_1573?

AF_1573 is a relatively small protein with the following characteristics:

• Full length: 131 amino acids

• Amino acid sequence: MRPQQYGGECGMKKKHVILILILLLPVVFLHIMLATWGLSMSFY VKRLSSPPQNYFEITE EDFREIPELKKIFEDLRKLAPGESRSYELDIDTGNKVHSYLTEKQAGVGECSYTYCFKYG DAYYGAHMGTP

• Contains a hydrophobic region (LILILLLPVVFLHIMLATW) suggesting a possible membrane association

• Features cysteine residues that might form disulfide bridges important for thermostability

• Lacks characterized functional domains based on current annotation

While the three-dimensional structure of AF_1573 has not been experimentally determined, structural prediction tools like AlphaFold2 can provide insights into its potential folding pattern . Prediction analysis indicates the presence of both alpha-helical and beta-sheet secondary structures that likely contribute to its stability at high temperatures.

What expression systems are most effective for producing recombinant AF_1573?

Several expression systems have been utilized for recombinant production of A. fulgidus proteins, with the following considerations specific to AF_1573:

E. coli expression system:

• Most commonly used for AF_1573 with a His-tag for purification

• Typically employs pET-based vectors with T7 promoter systems

• Benefits from codon optimization for archaeal proteins

• May require specialized E. coli strains (e.g., Rosetta) to address codon bias issues

Expression conditions optimization strategies:

• Temperature reduction (15-30°C) during induction to improve folding

• Use of chaperone co-expression to enhance solubility

• IPTG concentration titration (typically 0.1-1.0 mM)

• Extended induction periods (4-16 hours)

The purification of AF_1573 typically involves:

• Immobilized metal affinity chromatography (IMAC) using the His-tag

• Heat treatment step (60-70°C) to eliminate host proteins while preserving the thermostable target

• Size exclusion chromatography for final purification

What bioinformatic approaches are recommended for predicting AF_1573 function?

A comprehensive bioinformatic analysis workflow for uncharacterized proteins like AF_1573 should include:

Sequence-based approaches:

• BLAST and PSI-BLAST searches against multiple databases (NCBI, UniProt, PDB)

• Multiple sequence alignment with homologous proteins from related species

• Motif identification using PROSITE, PRINTS, or InterPro

• Transmembrane region prediction (TMHMM, Phobius)

• Signal peptide identification (SignalP)

Structure-based approaches:

• Secondary structure prediction (PSIPRED, JPred)

• 3D structure modeling (AlphaFold2, I-TASSER)

• Structural alignment with characterized proteins (DALI, TM-align)

• Active site prediction based on structural features (CASTp, SiteMap)

Genomic context analysis:

• Examination of neighboring genes in the A. fulgidus genome

• Operon prediction to identify functionally related genes

• Comparative genomics across multiple archaeal species

• Phylogenetic profiling to identify co-occurrence patterns

These methodologies have proven particularly effective for characterizing hypothetical proteins from extremophiles and can provide testable hypotheses about AF_1573 function.

What experimental methods are recommended for determining enzymatic activity of AF_1573?

When investigating potentially novel enzymatic activities in uncharacterized proteins like AF_1573, a systematic approach is essential:

Initial screening approaches:

• Activity-based proteomics using chemical probes

• Metabolite profiling in knockout/overexpression systems

• Substrate screening using compound libraries

• In vitro translation coupled with activity assays

Thermophile-specific considerations:

• Conduct assays at elevated temperatures (70-90°C)

• Use buffers with increased thermal stability (PIPES, HEPES)

• Account for altered pH optima at high temperatures

• Ensure substrate stability under assay conditions

Advanced analytical methods:

• Isothermal titration calorimetry for binding studies

• Surface plasmon resonance for interaction kinetics

• Mass spectrometry to identify reaction products

• NMR-based metabolomics to detect subtle changes in metabolite profiles

A systematic approach integrating multiple methods increases the likelihood of identifying physiologically relevant activities, particularly for proteins from extremophiles where standard assay conditions may not reflect native environments.

How do the thermal stability mechanisms of AF_1573 compare to other A. fulgidus proteins?

Archaeal proteins employ various mechanisms for thermal stability that may be relevant to AF_1573:

Comparative studies of AF_1573 with well-characterized A. fulgidus proteins like HMG-CoA reductase (which exhibits optimal activity at 85°C ) can provide insights into shared thermostability mechanisms. Differential scanning calorimetry (DSC) and circular dichroism (CD) spectroscopy at varying temperatures are recommended methods for quantitatively assessing AF_1573's thermal stability parameters.

What protein-protein interaction studies would be most informative for characterizing AF_1573?

Understanding the interaction partners of AF_1573 is crucial for functional characterization. The following methodologies are particularly suitable:

High-throughput screening approaches:

• Yeast two-hybrid screening adapted for thermophilic proteins

• Protein microarrays using the A. fulgidus proteome

• Proximity-dependent biotin identification (BioID) with thermostable biotin ligase

• Co-immunoprecipitation coupled with mass spectrometry (IP-MS)

Validation methodologies:

• Biolayer interferometry for quantitative binding kinetics

• Microscale thermophoresis for interaction studies under native-like conditions

• Analytical ultracentrifugation to determine complex stoichiometry

• FRET-based interaction assays with thermostable fluorescent proteins

Bioinformatic prediction of interactions:

• Co-evolution analysis using methods like GREMLIN or EVcouplings

• Structural docking predictions using ClusPro or HADDOCK

• Integration of genomic context and expression correlation data

When designing these experiments, consideration should be given to performing interaction studies at elevated temperatures (60-85°C) that better reflect the physiological conditions of A. fulgidus .

How can structural biology techniques be optimized for studying thermophilic proteins like AF_1573?

Structural characterization of thermophilic proteins presents unique challenges and opportunities:

X-ray crystallography considerations:

• Crystallization screening at elevated temperatures (30-60°C)

• Use of specialized crystallization additives for thermophilic proteins

• Implementation of reductive methylation to enhance crystallization

• Consideration of lipophilic additives if membrane association is suspected

NMR spectroscopy approaches:

• Acquisition of spectra at elevated temperatures to mimic native conditions

• Use of perdeuteration to improve spectral quality for the 131-residue protein

• Selective isotope labeling strategies for assignment simplification

• Solid-state NMR if membrane association is confirmed

Cryo-EM considerations:

• Utilization of recent advancements allowing structure determination of smaller proteins

• Implementation of GraFix method for stabilizing protein complexes

• Use of phase plates to enhance contrast for small proteins

Computational structural biology:

• Molecular dynamics simulations at elevated temperatures

• Enhanced sampling methods to explore conformational landscapes

• Quantum mechanics/molecular mechanics (QM/MM) for catalytic site analysis

The successful structural characterization of other A. fulgidus proteins, such as HMG-CoA reductase and DmpI , provides precedents and methodologies that can be adapted specifically for AF_1573.

How can evolutionary conservation analysis provide insights into AF_1573's functional domains?

Evolutionary analysis offers powerful insights into functionally important regions of uncharacterized proteins:

Recommended analytical pipeline:

• Collection of homologous sequences across diverse archaea and bacteria

• Construction of high-quality multiple sequence alignments

• Calculation of conservation scores using methods like ConSurf or Rate4Site

• Identification of co-evolving residue networks using statistical coupling analysis

• Mapping conservation patterns onto predicted structural models

Interpretation frameworks:

• Highly conserved surface patches often indicate binding interfaces

• Conserved cavities frequently represent active sites

• Co-evolving residue networks may indicate allosteric communication pathways

• Lineage-specific conservation patterns can suggest specialization of function

Case study application:
Analysis of other A. fulgidus proteins like HMG-CoA reductase has demonstrated how conservation analysis identified key catalytic residues (His390 and Lys277) that were subsequently confirmed by experimental mutagenesis . Similar approaches applied to AF_1573 could identify candidate residues for targeted functional studies.

What is known about the genomic context of AF_1573 and how might this inform functional hypotheses?

Genomic context analysis is particularly valuable for uncharacterized proteins:

A. fulgidus genome organization insights:

• AF_1573 gene location and neighboring genes

• Presence in potential operons or gene clusters

• Comparative analysis with syntenic regions in related species

• Association with mobile genetic elements or genomic islands

Transcriptomic correlations:

• Co-expression patterns with genes of known function

• Differential expression under various growth conditions

• Response to specific stressors (temperature, oxidative, nutrient limitation)

• Temporal expression profiles during growth phases

The complete genome sequencing of A. fulgidus strains provides the foundation for these analyses. Integration of genomic context data with protein interaction studies can significantly strengthen functional hypotheses for AF_1573.

What are the potential biotechnological applications of thermostable proteins like AF_1573?

Thermostable proteins from extremophiles offer numerous biotechnological opportunities:

Potential applications based on thermostability:

• Development of robust biocatalysts for industrial processes

• Creation of thermostable biosensors for harsh environments

• Design of heat-resistant enzymes for molecular biology applications

• Engineering of protein scaffolds for nanobiotechnology

Comparative advantages of thermostable proteins:

• Extended shelf-life and operational stability

• Resistance to chemical denaturants

• Functionality under diverse reaction conditions

• Compatibility with organic solvents

If AF_1573 is found to possess enzymatic activity, its thermostability would be particularly valuable for applications requiring high-temperature catalysis or extended operational stability.

How can CRISPR-Cas9 technology be applied to study the function of AF_1573 in vivo?

Genetic manipulation of archaea has advanced significantly, enabling functional genomics approaches:

CRISPR-Cas9 implementation strategies:

• Design of A. fulgidus-compatible CRISPR-Cas9 systems

• Development of appropriate selection markers

• Construction of shuttle vectors with thermostable components

• Optimization of transformation protocols for A. fulgidus

Functional genomic approaches:

• Gene knockout studies to determine phenotypic effects

• CRISPRi for controlled gene repression

• Creation of reporter fusions for localization studies

• Introduction of point mutations to test structure-function hypotheses

Challenges and considerations:

• High growth temperature requirements (70-85°C)

• Limited genetic tools specific to A. fulgidus

• Need for anaerobic growth conditions

• Potential essentiality of the target gene

While challenging, genetic manipulation of A. fulgidus would provide the most direct evidence for AF_1573 function in its native cellular context.

What methodological challenges exist in characterizing membrane-associated proteins from hyperthermophiles?

If bioinformatic analysis suggests AF_1573 has membrane association (indicated by its hydrophobic regions), specific methodological considerations become important:

Membrane protein-specific challenges:

• Structural characterization difficulties due to amphipathic nature

• Requirement for specialized detergents or nanodiscs

• Potential instability when removed from lipid environment

• Expression challenges in heterologous systems

Thermophile-specific considerations:

• Archaeal membrane composition differs significantly from bacterial or eukaryotic membranes

• Higher growth temperatures require specialized lipids

• Protein-lipid interactions may be essential for proper folding and function

• Experimental buffers must maintain stability at high temperatures

Recommended methodological approaches:

• Use of archaeal lipid extracts for reconstitution studies

• Implementation of native nanodiscs with thermostable membrane scaffold proteins

• Development of thermostable fluorescent lipid probes for interaction studies

• Application of hydrogen-deuterium exchange mass spectrometry at elevated temperatures

The combination of membrane association and thermophilic origin makes proteins like AF_1573 particularly challenging to study but potentially valuable as models for understanding protein stability in extreme environments.