Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1584 (AF_1584)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs unless otherwise specified. If you require dry ice shipping, please contact us in advance for arrangement. Additional fees may apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
While the tag type is determined during production, if you have a specific tag type requirement, please inform us. We will prioritize development of the specified tag whenever possible.
Synonyms
AF_1584; Uncharacterized protein AF_1584
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1584
Target Protein Sequence
MVRRGAMVLLTMLILYAAPSFALYGLADFMSFVYVGAIMIVAFGVYIILGRSKKPGFKEM LAVMLISALTAIFLAYFFSGSEVIVPKLKSLGLFAVVAAMLLALARVFRLEAEADFSLRF FLKWILVVAITFTILSVFMLFLRGVV
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1584

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and what ecological niches does it occupy?

Archaeoglobus fulgidus is a hyperthermophilic, sulfate-reducing archaeon belonging to the Archaeoglobi class of the Euryarchaeota phylum. This organism primarily inhabits marine hydrothermal systems and deep oil fields. The type strain VC16 was first isolated from marine hydrothermal vents, while strain 7324 was recovered from North Sea oil-field waters . A. fulgidus grows optimally at temperatures around 80°C under anaerobic conditions and exhibits versatile metabolic capabilities, including sulfate reduction, chemolithoautotrophic growth with carbon monoxide, and anaerobic oxidation of various hydrocarbons .

The organism has garnered significant scientific interest not only for its extremophilic properties but also for potential biotechnological applications. Recent research suggests that A. fulgidus could be utilized for bioremediation of oil-contaminated environments due to its resistance to anaerobic conditions, high temperatures, and elevated salt concentrations . This makes understanding its proteome, including uncharacterized proteins like AF_1584, particularly valuable for both basic science and applied research.

What is currently known about the uncharacterized protein AF_1584?

AF_1584 is one of the many uncharacterized proteins identified in the complete genome sequence of Archaeoglobus fulgidus . Based on the amino acid sequence provided in available databases, AF_1584 appears to be a membrane protein with several putative transmembrane domains . The protein sequence (MVRRG­AMVLL­TmLILY­AAPSF­ALYGL­ADFMS­FVYVG­AIMIV­AFGVY­IILGR­SKKPG­FKEML­AVmLI­SALTA­IFLAY­FFSGS­EVIVP­KLKSL­GLFAV­VAAmL­LALAR­VFRLE­AEADF­SLRFF­LKWIL­VVAIT­FTILS­VFmLF­LRGVV) contains multiple hydrophobic regions, suggesting membrane integration .

The protein is categorized as part of the substantial fraction of hypothetical proteins (HPs) that constitute a significant portion of both prokaryotic and eukaryotic proteomes . Like many HPs, AF_1584's biological function, interaction partners, and cellular role remain undetermined. Currently, recombinant versions of the protein are available for research purposes, enabling various structural and functional characterization approaches .

What are the optimal conditions for expressing recombinant AF_1584 in heterologous systems?

Successful expression of recombinant AF_1584 requires careful optimization due to its membrane protein nature and its origin from a hyperthermophilic organism. Based on documented approaches for similar proteins from A. fulgidus, the following expression conditions are recommended:

Expression System Selection:

  • E. coli strains specifically designed for membrane protein expression (such as C41(DE3) or C43(DE3)) should be considered to minimize toxicity.

  • Expression vectors with tightly regulated promoters (pET series) help control protein production rates.

Optimized Culture Conditions:

  • Initial growth at 37°C until OD600 reaches 0.5-0.6

  • Temperature reduction to 16-20°C prior to induction

  • Induction with low IPTG concentration (0.1-0.5 mM)

  • Extended expression period (16-20 hours) at reduced temperature

A comparable protocol that has proven successful for other A. fulgidus proteins involves growing E. coli BL21(DE3) cells in LB broth with appropriate antibiotics at 37°C until mid-log phase, reducing temperature to 16°C, adding 0.1 mM IPTG, and continuing incubation for approximately 16 hours before harvesting cells . For membrane proteins like AF_1584, supplementation with specific membrane protein folding chaperones may further improve expression yields.

What purification strategies are most effective for recombinant AF_1584?

Purification of recombinant AF_1584 requires specialized approaches that account for its membrane protein characteristics. The following multi-step strategy is recommended:

Membrane Fraction Isolation:

  • Cell lysis via sonication, French press, or enzymatic methods

  • Low-speed centrifugation to remove cell debris (10,000 × g, 20 min)

  • Ultracentrifugation to collect membrane fraction (100,000 × g, 1 hour)

Membrane Protein Solubilization:

  • Test multiple detergents for efficient solubilization (DDM, LDAO, or Triton X-100)

  • Include glycerol (10-20%) in buffers to enhance stability

  • Consider elevated temperature (40-50°C) during solubilization to mimic native conditions

Chromatographic Purification:

  • Affinity chromatography using the protein's affinity tag

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography for final polishing

For inclusion body recovery (if formed), a refolding strategy similar to that used for other A. fulgidus proteins can be employed, involving solubilization in denaturing buffers followed by controlled refolding through gradual detergent exchange or dilution .

The expected purity following this procedure should exceed 85% as assessed by SDS-PAGE . For storage, the purified protein is typically maintained in a buffer containing 50% glycerol at -20°C/-80°C, with expected stability of 6 months for liquid preparations and 12 months for lyophilized forms .

How can electrophoretic techniques be applied to characterize AF_1584?

Electrophoretic techniques provide fundamental information about protein properties and are essential for characterizing uncharacterized proteins like AF_1584. The following methods can be systematically applied:

SDS-PAGE Analysis:

  • Determines apparent molecular weight

  • Assesses sample purity

  • Monitors expression and purification efficiency

  • For membrane proteins, modified protocols using urea may improve resolution

Isoelectric Focusing (IEF):

  • Determines the isoelectric point (pI) of AF_1584

  • Provides information about the protein's charge properties

  • Requires specialized ampholytes suitable for membrane proteins

Two-Dimensional Gel Electrophoresis:
A powerful approach combining IEF and SDS-PAGE that enables:

  • Comprehensive proteomic analysis

  • Detection of potential post-translational modifications

  • Comparison with proteome databases

The typical workflow as described in research on protein characterization follows this pattern:

  • Sample preparation (may require specialized detergents for membrane proteins)

  • First dimension separation based on pI

  • Second dimension separation based on molecular weight

  • Protein visualization using appropriate staining methods

  • Image analysis and spot identification

For membrane proteins like AF_1584, specialized detergents and modified protocols are essential for accurate analysis. The electrophoretic mobility data can be correlated with the amino acid sequence to validate the protein's identity and integrity.

What mass spectrometry approaches are most informative for AF_1584 characterization?

Mass spectrometry (MS) provides detailed molecular characterization of proteins and is particularly valuable for uncharacterized proteins like AF_1584. Multiple MS approaches can be applied in a complementary manner:

Peptide Mass Fingerprinting:

  • Enzymatic digestion (typically trypsin) of AF_1584

  • MALDI-MS analysis of resulting peptides

  • Matching experimental peptide masses against theoretical digestion patterns

  • Confirms protein identity with high confidence

Tandem MS (MS/MS) Analysis:

  • Enables peptide sequencing through fragmentation

  • Provides definitive identification even in complex samples

  • Particularly important for larger proteins like AF_1584

  • Can identify post-translational modifications

Specialized MS Applications:

  • Hydrogen/deuterium exchange MS to probe protein structure

  • Native MS to determine oligomeric state and stability

  • Cross-linking MS to identify interaction partners

  • Top-down proteomics for intact protein analysis

As noted in the literature, recent advancements in MS technology include:

  • Robotic sample handling for increased throughput

  • Nanospray ionization for analyzing minute sample volumes

  • Improved sensitivity and mass accuracy for more reliable identification

For optimal results with membrane proteins like AF_1584, specialized sample preparation protocols including appropriate detergents or organic solvents are required to ensure complete solubilization and digestion prior to MS analysis.

What spectroscopic methods can reveal structural features of AF_1584?

Multiple spectroscopic techniques can provide valuable structural information about AF_1584, each offering distinct insights:

Circular Dichroism (CD) Spectroscopy:

  • Determines secondary structure composition (α-helices, β-sheets)

  • Monitors thermal stability through temperature-dependent measurements

  • Assesses conformational changes upon ligand binding

  • Provides relatively rapid analysis with minimal sample requirements

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Offers atomic-level structural information

  • Can analyze dynamics and flexibility of protein regions

  • May require isotopic labeling (13C, 15N) for detailed analysis

  • For membrane proteins like AF_1584, solid-state NMR may be more appropriate

Fourier Transform Infrared (FTIR) Spectroscopy:

  • Particularly useful for membrane proteins

  • Provides information about secondary structure in lipid environments

  • Can analyze protein orientation in membranes

  • Requires minimal sample preparation

Fluorescence Spectroscopy:

  • Probes tertiary structure around aromatic residues

  • Monitors conformational changes and binding events

  • Can be used for thermal stability studies

  • May require introduction of fluorescent probes

For membrane proteins like AF_1584, these techniques often require optimization of buffer conditions, detergent selection, and possibly reconstitution into lipid environments to obtain meaningful structural data that reflects the protein's native conformation.

What bioinformatics approaches can predict potential functions of AF_1584?

Computational prediction of protein function is particularly valuable for uncharacterized proteins like AF_1584. A multi-layered bioinformatics approach combines several methods:

Sequence-Based Analysis:

  • Homology searches against protein databases using BLAST and HMM profiles

  • Identification of conserved domains using Pfam, InterPro, and SMART

  • Motif discovery using MEME for identification of functional elements

  • Transmembrane topology prediction using TMHMM or MEMSAT

  • Signal peptide prediction using SignalP

Structure-Based Predictions:

  • Homology modeling based on related proteins with known structures

  • Ab initio structure prediction using methods like AlphaFold

  • Structure-based function annotation using programs like ProFunc

Genomic Context Analysis:

  • Gene neighborhood examination to identify functionally related genes

  • Phylogenetic profiling to identify co-evolving proteins

  • Protein-protein interaction network prediction using STRING

Integrative Approaches:

  • Machine learning methods combining multiple features

  • Consensus from multiple prediction tools

  • Correlation with experimental data from related proteins

The accuracy of these predictions varies, with sequence-based methods typically providing broader functional classification, while structural and contextual analyses offer more specific functional hypotheses. For membrane proteins like AF_1584, specialized prediction tools optimized for transmembrane proteins should be prioritized.

Prediction MethodInformation ProvidedLimitations for Membrane Proteins
Sequence homologyFunctional family classificationLess sensitive for divergent sequences
Domain predictionIdentification of functional unitsMay miss novel domains
Transmembrane predictionMembrane topologyVariable accuracy across methods
Structure prediction3D structural modelLess accurate for membrane proteins
Genomic contextFunctional associationsLimited by genome annotation quality

As emphasized in the literature, these in silico predictions should be considered hypotheses requiring experimental validation .

How can protein-protein interaction studies illuminate AF_1584 function?

Identifying interaction partners is a powerful approach to understand the function of uncharacterized proteins like AF_1584. Several complementary methods can be applied:

Affinity-Based Methods:

  • Affinity purification coupled with mass spectrometry (AP-MS)

  • Pull-down assays using recombinant AF_1584 as bait

  • Co-immunoprecipitation if specific antibodies are available

  • For membrane proteins, these methods require careful detergent selection to maintain interactions

Yeast Two-Hybrid (Y2H) and Variants:

  • Classical Y2H for soluble domains of AF_1584

  • Membrane yeast two-hybrid (MYTH) system specifically designed for membrane proteins

  • Bacterial two-hybrid systems as alternatives for prokaryotic proteins

Protein Complementation Assays:

  • Split-protein reporters (e.g., split-luciferase)

  • Bimolecular fluorescence complementation (BiFC)

  • These methods can detect interactions in near-native conditions

Chemical Cross-Linking:

  • Covalent stabilization of transient interactions

  • Cross-linked complexes identified by mass spectrometry

  • Particularly valuable for membrane proteins to capture interactions before detergent solubilization

In Vitro Methods:

  • Surface plasmon resonance (SPR) for quantitative binding analysis

  • Microscale thermophoresis (MST) for measuring interactions in solution

  • Analytical ultracentrifugation to characterize complexes

When studying hyperthermophilic proteins like AF_1584, temperature considerations are critical - interaction studies may need to be conducted at elevated temperatures (40-60°C) to mimic native conditions. Additionally, reconstitution into lipid environments may be necessary to observe physiologically relevant interactions for membrane proteins.

What approaches can determine if AF_1584 undergoes post-translational modifications?

Post-translational modifications (PTMs) often play crucial roles in protein function and regulation. For uncharacterized proteins like AF_1584, several methods can detect and characterize PTMs:

Mass Spectrometry-Based Approaches:

  • Shotgun proteomics with enrichment techniques for specific PTMs

  • Targeted MS methods (MRM/PRM) for known modification sites

  • Top-down MS for intact protein analysis with modifications

  • High-resolution MS to determine precise mass shifts

Specific Enrichment Strategies:

  • Phosphorylation: Immobilized metal affinity chromatography (IMAC), phospho-specific antibodies

  • Glycosylation: Lectin affinity chromatography, hydrazide chemistry

  • ADP-ribosylation: Macrodomain-based enrichment using AF1521 from A. fulgidus

  • Ubiquitination/SUMOylation: Antibody-based enrichment

Gel-Based Detection:

  • Phosphorylation-specific stains (Pro-Q Diamond)

  • Glycoprotein stains (Pro-Q Emerald)

  • Mobility shift assays in modified electrophoresis conditions

Bioinformatic Prediction:

  • PTM site prediction tools (NetPhos, NetNGlyc, etc.)

  • Conservation analysis of potential modification sites

  • Structural context assessment of predicted sites

For archaeal proteins like AF_1584, common modifications include glycosylation, phosphorylation, methylation, and acetylation. The hyperthermophilic nature of A. fulgidus may also result in unique modifications that contribute to protein stability at high temperatures.

As described for other proteins, the macrodomain-based detection method using AF1521 (ironically, also from A. fulgidus) has proven effective for capturing ADP-ribosylated proteins and could potentially be applied to study AF_1584 if this modification is present .

What methods can elucidate the membrane topology of AF_1584?

Understanding the membrane topology of AF_1584 is essential for functional characterization. Several experimental approaches can map the organization of transmembrane segments and determine which regions face the cytoplasm versus the extracellular/periplasmic space:

Cysteine Scanning Mutagenesis:

  • Systematic replacement of residues with cysteine

  • Selective labeling with membrane-impermeable reagents

  • Accessibility patterns reveal membrane topology

  • Requires generation of a cysteine-free background variant

Protease Protection Assays:

  • Limited proteolysis of intact membrane vesicles

  • Mass spectrometry identification of protected fragments

  • Comparison with proteolysis of permeabilized membranes

  • Reveals domains protected by the membrane barrier

Epitope Insertion and Antibody Accessibility:

  • Introduction of epitope tags at various positions

  • Immunolabeling without membrane permeabilization

  • Accessible epitopes indicate extracellular/periplasmic localization

Fluorescence Approaches:

  • Environment-sensitive fluorescent probes

  • Fluorescence quenching experiments

  • FRET-based distance measurements between domains

Structural Methods:

  • Cryo-electron microscopy in nanodiscs or detergent

  • Solid-state NMR with oriented membranes

  • X-ray crystallography (challenging but potentially highly informative)

When applied to hyperthermophilic membrane proteins like AF_1584, these methods may require adaptation for higher temperature conditions and consideration of the more rigid membrane compositions found in archaea. The experimental topology data should be compared with computational predictions from tools like TMHMM, MEMSAT, and TOPCONS to develop a comprehensive topological model.

How can crystallography or cryo-EM be applied to determine the structure of AF_1584?

Obtaining high-resolution structural information for membrane proteins like AF_1584 presents significant challenges but offers tremendous insight into function. Both X-ray crystallography and cryo-electron microscopy (cryo-EM) approaches can be adapted for this purpose:

X-ray Crystallography Approach:

  • Construct Optimization:

    • Systematic terminal truncations

    • Loop engineering to enhance crystal contacts

    • Fusion with crystallization chaperones (e.g., T4 lysozyme)

    • Removal of flexible regions

  • Crystallization Strategies:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle-based crystallization

    • Vapor diffusion with detergent-solubilized protein

    • Sparse matrix screening at elevated temperatures (30-60°C)

  • Data Collection Considerations:

    • Synchrotron radiation with microbeam capability

    • Serial crystallography for microcrystals

    • Room temperature data collection to capture conformational states

Cryo-EM Approach:

  • Sample Preparation:

    • Reconstitution in nanodiscs or amphipols

    • Vitrification optimization for hyperthermophilic proteins

    • Detergent screening for optimal contrast

  • Data Collection Strategy:

    • High-resolution direct electron detectors

    • Energy filters to improve contrast

    • Tilt series to address preferred orientation issues

  • Analysis Considerations:

    • 3D classification to identify conformational states

    • Particle subtraction for flexible domains

    • Local resolution assessment

For both methods, protein stability at room temperature may be advantageous for a hyperthermophilic protein like AF_1584. The thermostability of proteins from A. fulgidus can actually simplify some aspects of structural studies by providing more robust samples during handling and data collection.

Successful structural determination would provide critical insights into the arrangement of transmembrane helices, potential binding sites, and functional domains of AF_1584, dramatically accelerating functional characterization efforts.

What specialized approaches are needed to study protein dynamics of AF_1584 at high temperatures?

Understanding the dynamics of hyperthermophilic proteins like AF_1584 at their physiologically relevant temperatures requires specialized techniques and adaptations:

Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Custom high-temperature exchange apparatus

  • Rapid cooling after exchange to quench the reaction

  • Temperature-controlled LC systems

  • Analysis of exchange rates at multiple temperatures (20-80°C)

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Temperature-resistant NMR tubes and equipment

  • Pressure-resistant sample cells to prevent boiling

  • Relaxation dispersion experiments at elevated temperatures

  • Chemical shift analysis across temperature ranges

Molecular Dynamics (MD) Simulations:

  • Enhanced sampling methods for high-temperature simulations

  • Specialized force fields validated for thermophilic proteins

  • Simulations in archaeal-like membrane compositions

  • Comparison of dynamics across temperature ranges (25-80°C)

Single-Molecule Fluorescence Techniques:

  • Temperature-controlled microscopy stages

  • Thermostable fluorophores with minimal photobleaching at high temperatures

  • Microfluidic devices for rapid temperature changes

  • FRET-based approaches to measure domain movements

Spectroscopic Approaches:

  • Variable-temperature circular dichroism (CD)

  • Pressure-perturbation calorimetry

  • Time-resolved fluorescence spectroscopy

  • Infrared spectroscopy with temperature control

These methods can reveal how AF_1584 maintains structural integrity at high temperatures while retaining necessary flexibility for function. Of particular interest would be characterizing any temperature-dependent conformational changes that might be linked to function, such as substrate binding, oligomerization, or interaction with other proteins.

As demonstrated in studies of other A. fulgidus proteins such as AfAgo, techniques like single-molecule FRET and atomic force microscopy can be successfully applied to characterize protein dynamics and interactions .

How does AF_1584 compare to other uncharacterized proteins in A. fulgidus?

Comparative analysis of AF_1584 with other uncharacterized proteins in A. fulgidus provides important context for understanding its potential function and significance:

Genomic Context Comparison:
The A. fulgidus genome contains 2,436 open reading frames (ORFs), of which approximately 25% (651 ORFs) encode functionally uncharacterized yet conserved proteins . AF_1584 is one of these uncharacterized proteins, but comparative analysis can reveal whether it exists in genomic proximity to functionally characterized genes, potentially indicating involvement in specific pathways.

Sequence-Based Classification:
Analysis can determine whether AF_1584 belongs to larger protein families or contains recognizable domains shared with other uncharacterized proteins in A. fulgidus. For instance, comparison with AF_2121, another uncharacterized protein mentioned in the search results , could reveal whether these proteins share common features.

Expression Pattern Analysis:
Transcriptomic and proteomic data can indicate whether AF_1584 is co-expressed with other proteins under specific conditions, such as different growth substrates (e.g., CO oxidation coupled to sulfate reduction ) or stress conditions.

Structural Feature Comparison:
Predicted secondary structure elements, transmembrane regions, and motifs can be compared across the uncharacterized proteome to identify proteins with similar architectural features. This may reveal functional clusters among currently uncharacterized proteins.

The complete genome analysis of A. fulgidus indicated that about two-thirds of its uncharacterized proteins are shared with another archaeon, Methanococcus jannaschii (428 ORFs) . Determining whether AF_1584 falls within this shared group or is unique to A. fulgidus provides evolutionary context and helps prioritize it for functional characterization.

What can be learned from comparing AF_1584 with characterized proteins from other extremophiles?

Comparative analysis with characterized proteins from other extremophiles can provide valuable functional and evolutionary insights about AF_1584:

Homology Identification:

  • BLAST and profile-based searches against extremophile databases

  • Identification of distant homologs with known functions

  • Analysis of conservation patterns in hyperthermophilic vs. mesophilic organisms

Structural Feature Comparison:

  • Analysis of amino acid composition (e.g., increased charged residues)

  • Comparison of hydrophobic core composition

  • Identification of stabilizing features common in thermophiles

  • Membrane integration strategies in hyperthermophiles

Functional Adaptation Analysis:

  • Comparison with functionally characterized membrane proteins from other extremophiles

  • Identification of conserved residues across temperature ranges

  • Analysis of temperature-dependent functional mechanisms

Evolutionary Context:

  • Phylogenetic analysis to determine the evolutionary history of AF_1584

  • Horizontal gene transfer assessment

  • Identification of archaeal-specific versus universal features

This comparative approach may reveal that AF_1584 belongs to a protein family with known functions in other extremophiles, even if sequence similarity is too low for standard homology detection. Additionally, comparing AF_1584 with characterized extremophilic proteins can highlight structural adaptations that contribute to thermostability, providing insights into both function and evolutionary adaptation mechanisms.

For example, analysis of another A. fulgidus protein, the uracil DNA glycosylase, revealed a unique iron-sulfur cluster loop motif that plays a crucial role in its function . Similar distinctive structural elements might be present in AF_1584 and could be identified through careful comparative analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.