Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1598 (AF_1598)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Characteristics

AF_1598 is produced as a full-length recombinant protein (1–103 amino acids) in E. coli, optimized for research applications . Key details include:

ParameterValue
Host OrganismE. coli
Source SpeciesArchaeoglobus fulgidus
TagHis-tag
Protein Length103 amino acids (Full Length)
PriceAvailable upon request

No functional annotations or pathway associations are currently documented for AF_1598 .

Current Research Status

AF_1598 remains a "dark" protein with no established roles in metabolism, signaling, or stress responses. Key gaps include:

  • Pathway Involvement: No pathways (e.g., glycosylation, DNA repair) have been linked to AF_1598 .

  • Functional Interactions: No direct protein-molecule interactions or binding partners are documented .

  • Experimental Validation: Structural predictions lack biochemical corroboration.

Potential Research Directions

  1. Functional Genomics: Knockout studies in A. fulgidus to identify phenotypic changes.

  2. Structural Biology: Co-crystallization with ligands to probe binding pockets.

  3. Comparative Analysis: Sequence alignment with orthologs from other archaea to infer conserved motifs.

Availability and Applications

AF_1598 is commercially available as a recombinant protein for research purposes, enabling downstream studies such as:

  • Enzyme Activity Assays: Testing for catalytic roles (e.g., hydrolase, oxidoreductase).

  • Protein-Protein Interaction Screens: Identifying binding partners via affinity chromatography.

  • Biophysical Characterization: Thermal stability assays or NMR studies.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs unless otherwise specified. For dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We advise centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
AF_1598; Uncharacterized protein AF_1598
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1598
Target Protein Sequence
MVTKRSLLKLYLLGIVTLGIYFIYWLVMVKRELNSLGANIPTCWLLIIPIANIYWLYKFA EGFVKVLKPGESAVLYFLLFWLVSIIMPAIVQSELNKLAERGG
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1598

STRING: 224325.AF1598

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the structural characteristics of AF_1598?

AF_1598 is a full-length protein consisting of 103 amino acids from the hyperthermophilic archaeon Archaeoglobus fulgidus. It is available as a recombinant protein with a His-tag, expressed in E. coli expression systems . Unlike many characterized proteins from A. fulgidus, AF_1598 remains largely uncharacterized in terms of its three-dimensional structure.

For structural characterization, researchers should consider employing:

  • X-ray crystallography following protein purification

  • Nuclear magnetic resonance (NMR) spectroscopy for solution structure determination

  • Cryo-electron microscopy for larger protein complexes

  • In silico structure prediction using AlphaFold2 or similar advanced tools

These approaches should be complemented with biophysical characterization methods such as circular dichroism (CD) spectroscopy to determine secondary structure elements, and differential scanning calorimetry (DSC) to assess thermal stability, particularly important given the hyperthermophilic nature of the source organism.

What expression systems are suitable for producing recombinant AF_1598?

Expression SystemAdvantagesConsiderations for AF_1598
E. coliHigh yield, cost-effective, rapid growthMay lack proper folding for archaeal proteins, potential issues with disulfide bonds
Yeast (S. cerevisiae/P. pastoris)Eukaryotic post-translational modifications, proper foldingSimilar to TGTA protein expression which uses yeast systems successfully
Cell-free systemsAvoids toxicity issues, rapid productionUseful for initial characterization studies
Archaeal hosts (e.g., Sulfolobus)Native-like environmentMore challenging but potentially better for functional studies

When expressing archaeal proteins like AF_1598, researchers should optimize codon usage for the selected expression system and consider adding solubility-enhancing tags beyond the His-tag if expression or solubility challenges arise. Temperature optimization is also critical for proper folding of proteins from hyperthermophilic organisms.

How can I verify the purity and integrity of recombinant AF_1598?

Methodological approach for quality control of recombinant AF_1598:

  • SDS-PAGE analysis: Run purified protein on 15-18% gels (suitable for smaller proteins like AF_1598) alongside molecular weight markers. Expect a band at approximately 11-12 kDa plus the weight of the His-tag.

  • Western blot: Use anti-His antibodies to confirm the presence of the tagged protein.

  • Mass spectrometry:

    • MALDI-TOF MS to confirm molecular weight

    • LC-MS/MS for peptide fingerprinting and sequence verification

  • Size exclusion chromatography: Assess protein homogeneity and oligomeric state.

  • Dynamic light scattering: Evaluate size distribution and aggregation status.

For archaeal proteins like AF_1598, it's particularly important to assess proper folding through circular dichroism spectroscopy, as expression in mesophilic hosts may result in improper folding of thermophilic proteins.

What approaches should I use to determine the function of uncharacterized protein AF_1598?

As AF_1598 remains uncharacterized , a systematic multi-omics approach is recommended:

  • Bioinformatic analysis:

    • Sequence homology searches against characterized proteins

    • Identification of conserved domains/motifs

    • Phylogenetic analysis to identify potential orthologs with known functions

    • Structural prediction and comparison with functionally characterized proteins

  • Protein interaction studies:

    • Pull-down assays with cell lysates from A. fulgidus

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

    • Co-immunoprecipitation followed by mass spectrometry

  • Gene neighborhood analysis:

    • Examine genes adjacent to AF_1598 in the A. fulgidus genome

    • Look for operonic structures that might suggest functional relationships

  • Transcriptomic analysis:

    • Compare expression patterns with genes of known function under various conditions

    • Identify conditions that upregulate or downregulate AF_1598 expression

  • Phenotypic studies:

    • Gene deletion/knockdown experiments if genetic systems are available

    • Heterologous expression followed by phenotypic analysis

These approaches should be integrated to develop testable hypotheses regarding AF_1598 function, with subsequent biochemical assays designed based on predicted functions.

How can I investigate potential protein-protein interactions involving AF_1598?

For investigating protein-protein interactions involving this uncharacterized protein, employ a strategic combination of methods:

  • In vitro approaches:

    • Surface plasmon resonance (SPR) with purified potential interactors

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters of interactions

    • Microscale thermophoresis (MST) for detecting interactions under near-native conditions

    • Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS)

  • Crosslinking mass spectrometry:

    • Use chemical crosslinkers followed by LC-MS/MS to capture transient interactions

    • Analyze proximity data to generate interaction models

  • Thermal shift assays:

    • Differential scanning fluorimetry with potential binding partners

    • Monitor changes in protein thermal stability upon interaction

  • Cellular approaches:

    • FRET or BRET assays with fluorescently tagged proteins

    • Proximity ligation assays in cellular contexts

    • Bimolecular fluorescence complementation

  • Native mass spectrometry:

    • Direct analysis of intact protein complexes

    • Determination of stoichiometry and stability

When designing these experiments, consider the extreme thermophilic nature of A. fulgidus, which may require modifications to standard protocols to accommodate high-temperature interactions or structural changes that occur at elevated temperatures.

What are the best practices for analyzing post-translational modifications in AF_1598?

Although no specific post-translational modifications (PTMs) of AF_1598 have been reported in the available literature, archaeal proteins often undergo unique modifications. A comprehensive PTM analysis workflow includes:

  • Sample preparation strategies:

    • Enrichment techniques specific to modification types (phosphopeptides, glycopeptides)

    • Protection of labile modifications during extraction and processing

    • Use of modification-specific antibodies for enrichment where applicable

  • Mass spectrometry approaches:

    • High-resolution MS/MS for precise mass determination

    • Electron transfer dissociation (ETD) for preserving labile modifications

    • Parallel reaction monitoring (PRM) for targeted analysis of modified peptides

    • Data-independent acquisition (DIA) for comprehensive detection

  • Specialized analysis for archaeal-specific modifications:

    • Detection of sulfation, methylation, and acetylation common in Archaea

    • Analysis of unique archaeal glycosylation patterns

  • Bioinformatic prediction:

    • Use of archaeal-specific PTM prediction algorithms

    • Homology-based prediction based on characterized archaeal proteins

  • Functional validation:

    • Site-directed mutagenesis of predicted modification sites

    • Biochemical assays to assess the impact of modifications on function

When analyzing AF_1598, special attention should be paid to the hyperthermophilic environment of A. fulgidus, as PTMs may play critical roles in protein stability at extreme temperatures.

How can contradictions in experimental data about AF_1598 be resolved methodologically?

When facing conflicting experimental results with AF_1598 or other uncharacterized proteins:

  • Systematic variation analysis:

    • Vary experimental conditions systematically to identify factors causing discrepancies

    • Test multiple expression systems to rule out expression-related artifacts

    • Compare results between different protein batches and purification methods

  • Multi-technique validation:

    • Apply orthogonal methods to verify observations

    • For functional studies, use both in vitro and in vivo approaches

    • Complement biochemical assays with biophysical and structural studies

  • Reproducibility assessment:

    • Implement rigorous statistical analysis

    • Perform biological and technical replicates

    • Consider inter-laboratory validation for persistent contradictions

  • Control experiments:

    • Include appropriate positive and negative controls

    • Use closely related proteins as comparators

    • Test recombinant protein alongside native protein where possible

  • Environmental conditions consideration:

    • Test at physiologically relevant temperatures for A. fulgidus (approximately 83°C)

    • Examine the effects of pH, salt concentration, and redox state

    • Consider the anaerobic nature of A. fulgidus when designing experiments

What are the considerations for designing DNA constructs for structure-function studies of AF_1598?

When designing DNA constructs for structure-function analysis of AF_1598, consider:

  • Expression vector selection:

    • Temperature-inducible promoters for better control of expression

    • Vectors with appropriate selection markers for the chosen host

    • Consideration of copy number effects on expression levels

  • Affinity tag strategies:

    • N-terminal vs. C-terminal His-tag placement based on predicted functional domains

    • Inclusion of protease cleavage sites for tag removal

    • Alternative tags (GST, MBP) for enhanced solubility or specific applications

  • Domain mapping constructs:

    • Full-length constructs (1-103 amino acids)

    • Truncation series to identify functional domains

    • Domain swapping with related proteins to identify critical regions

  • Mutagenesis strategy:

    • Alanine-scanning mutagenesis of conserved residues

    • Charge reversal mutations to probe electrostatic interactions

    • Conservative vs. non-conservative substitutions

  • Codon optimization:

    • Adapting the archaeal coding sequence for expression in mesophilic hosts

    • Avoiding rare codons in the expression host

    • Considering GC content for efficient transcription

These design considerations should be integrated with bioinformatic analysis of the AF_1598 sequence to identify potential functional regions or domains worth targeting in structure-function studies.

What are the optimal assay conditions for studying the biochemical properties of AF_1598?

Given that AF_1598 comes from the hyperthermophilic archaeon A. fulgidus, assay conditions should reflect its native environment:

  • Temperature considerations:

    • Primary assays should be conducted at 80-85°C (optimal growth temperature of A. fulgidus)

    • Temperature range studies (60-100°C) to determine optimal activity and stability

    • Include appropriate temperature-stable controls and reagents

  • Buffer systems:

    • pH range testing from 5.5-8.0, with emphasis around pH 7.0 (near-neutral pH of A. fulgidus cytoplasm)

    • High ionic strength buffers (0.1-0.5 M NaCl or KCl) to mimic archaeal conditions

    • Consideration of anaerobic conditions for functional assays

  • Stability enhancers:

    • Addition of osmolytes like trimethylamine N-oxide (TMAO) or glycine betaine

    • Testing cofactor requirements (metal ions, particularly Fe, Ni, Co as relevant to A. fulgidus)

    • Reducing agents to maintain physiological redox state

  • Control experiments:

    • Parallel assays with heat-denatured protein

    • Comparison with well-characterized archaeal proteins as positive controls

    • Time-course studies to ensure steady-state conditions

  • Equipment adaptations:

    • Use of high-temperature stable microplates or sealed glass containers

    • Temperature-controlled spectrophotometers or plate readers

    • Consideration of evaporation effects in extended assays

These optimized conditions will help ensure that any observed activity reflects the true biochemical properties of AF_1598 in its native environment rather than artifacts from non-physiological conditions.

How should differential gene expression studies involving AF_1598 be designed and analyzed?

For comprehensive transcriptomic analysis involving AF_1598:

  • Experimental design:

    • Compare multiple growth conditions relevant to A. fulgidus ecology (varying temperature, pH, carbon sources, electron acceptors)

    • Include time-course sampling to capture temporal expression patterns

    • Design biological and technical replicates for statistical robustness

  • RNA extraction considerations:

    • Use specialized protocols for archaeal RNA extraction to preserve integrity

    • Include appropriate controls to assess RNA quality (RIN values > 8)

    • Consider additional purification steps to remove contaminating DNA

  • Sequencing approach:

    • RNA-Seq with sufficient depth (>20 million reads per sample)

    • Strand-specific library preparation to capture antisense transcription

    • Consider 5'-end mapping techniques to identify transcription start sites

  • Data analysis workflow:

    • Quality control and adapter trimming

    • Alignment to A. fulgidus reference genome

    • Normalization methods appropriate for archaeal transcriptomes

    • Differential expression analysis using DESeq2 or similar tools

  • Validation strategies:

    • qRT-PCR validation of expression changes for AF_1598

    • Northern blot analysis for confirmation of transcript size

    • Reporter gene assays to validate promoter activity

  • Co-expression network analysis:

    • Identify genes with similar expression patterns to AF_1598

    • Functional enrichment analysis of co-expressed genes

    • Integration with protein-protein interaction data

This comprehensive approach will help contextualize AF_1598 within the broader transcriptional landscape of A. fulgidus and may provide insights into its functional role and regulation.

How does AF_1598 compare to other uncharacterized proteins in Archaeoglobus fulgidus?

Comparative analysis of AF_1598 with other uncharacterized proteins can provide important contextual information:

  • Sequence-based comparisons:

    • Multiple sequence alignment with other uncharacterized A. fulgidus proteins

    • Clustering analysis to identify potential paralogous relationships

    • Assessment of conservation patterns across related sequences

  • Structural comparisons:

    • Structural prediction comparison using tools like AlphaFold2

    • Domain architecture analysis

    • Identification of shared structural motifs despite low sequence similarity

  • Genomic context analysis:

    • Comparison of gene neighborhood patterns

    • Identification of shared regulatory elements

    • Co-occurrence patterns in different archaeal species

  • Expression pattern comparison:

    • Analysis of co-expression networks

    • Identification of shared transcriptional regulators

    • Response to similar environmental conditions

  • Evolutionary rate analysis:

    • Calculation of dN/dS ratios to assess selection pressure

    • Comparison of evolutionary conservation across archaeal lineages

    • Identification of rapidly evolving vs. conserved regions

This comparative approach may reveal functional relationships between AF_1598 and other uncharacterized proteins, potentially allowing functional inferences based on the principle that functionally related proteins often share similar properties or evolutionary patterns.

What insights can be gained from comparing AF_1598 with the characterized protein TGTA from the same organism?

Comparing the uncharacterized AF_1598 with the characterized 7-Cyano-7-Deazaguanine tRNA-Ribosyltransferase (TGTA) from A. fulgidus provides a methodological framework for functional inference:

  • Structural comparison:

    • AF_1598 is a relatively small protein (103 amino acids) compared to TGTA (481 amino acids)

    • Potential domain sharing or structural similarity analysis despite size differences

    • Analysis of potential interaction surfaces or binding pockets

  • Expression system insights:

    • TGTA has been successfully expressed in yeast expression systems , suggesting potential approaches for AF_1598

    • Comparison of purification strategies and protein stability characteristics

    • Optimization of expression conditions based on TGTA protocols

  • Functional association assessment:

    • Evaluation of potential functional relationships in tRNA modification pathways

    • Co-expression analysis under conditions known to induce TGTA expression

    • Investigation of potential protein-protein interactions between AF_1598 and TGTA

  • Evolutionary context:

    • Comparative analysis of conservation patterns across archaeal species

    • Assessment of co-evolution signals that might indicate functional relationships

    • Analysis of gene neighborhood patterns in relation to tRNA processing genes

This comparative approach leverages existing knowledge about TGTA to generate testable hypotheses about AF_1598's potential role in A. fulgidus, particularly in the context of RNA processing or modification.

What are the most promising future research directions for understanding AF_1598 function?

Based on current knowledge and methodological approaches, future research on AF_1598 should focus on:

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, and cryo-EM with computational modeling

    • Structural comparison with characterized archaeal proteins

    • Structure-guided functional hypothesis generation

  • Systems biology integration:

    • Multi-omics data integration (transcriptomics, proteomics, metabolomics)

    • Network analysis to position AF_1598 in cellular pathways

    • Perturbation studies to assess systemic effects of AF_1598 manipulation

  • Functional screening approaches:

    • Development of high-throughput assays to test multiple potential functions

    • Heterologous expression in model organisms with phenotypic screening

    • Library-based approaches to identify interacting partners or substrates

  • Evolutionary functional inference:

    • Deeper phylogenetic analysis across archaeal lineages

    • Ancestral sequence reconstruction and functional testing

    • Comparative genomics to identify co-evolving gene clusters

  • Advanced genetic approaches:

    • Development or application of genetic systems for A. fulgidus

    • CRISPR-based approaches for gene editing and regulation

    • Synthetic biology approaches to reconstruct minimal functional units

These research directions, pursued in parallel, will maximize the chance of elucidating the function of AF_1598 and contribute to our broader understanding of archaeal biology and evolution.

How should researchers approach contradictory findings in AF_1598 research literature?

When encountering contradictions in the scientific literature regarding AF_1598 or similar uncharacterized proteins:

  • Systematic literature assessment:

    • Catalog all experimental conditions, methods, and materials used across studies

    • Identify key variables that differ between contradictory reports

    • Assess the quality and reproducibility measures in each study

  • Meta-analysis approach:

    • Quantitatively combine data across studies where possible

    • Apply statistical methods to assess heterogeneity

    • Identify potential moderating variables explaining contradictions

  • Replication strategy:

    • Design experiments that specifically address contradictory points

    • Include conditions matching both original studies

    • Extend experimental conditions to identify threshold effects

  • Collaborative resolution:

    • Engage with authors of contradictory studies

    • Consider multi-laboratory validation studies

    • Share materials and protocols to eliminate technical variations

  • Theoretical reconciliation:

    • Develop models that could explain seemingly contradictory results

    • Consider context-dependent functions or condition-specific effects

    • Examine whether contradictions might reflect different aspects of a complex function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.