Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1618 (AF_1618)

Shipped with Ice Packs
In Stock

Description

Overview and Production

Recombinant AF_1618 is a 187-amino-acid protein (UniProt ID: O28655) expressed in Escherichia coli and purified via affinity chromatography leveraging its His tag . The protein is supplied as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0) to enhance stability . Key production details include:

ParameterSpecification
Host OrganismEscherichia coli
TagN-terminal His tag
Purity>90% (verified by SDS-PAGE)
Storage-20°C/-80°C (lyophilized); short-term storage at 4°C in 5–50% glycerol
Reconstitution0.1–1.0 mg/mL in sterile water, with glycerol for long-term stability

Functional Insights

Despite its "uncharacterized" designation, indirect evidence suggests potential roles:

  • DNA Repair Pathways: While AF_1618 itself has not been directly studied, A. fulgidus encodes proteins involved in base excision repair (BER), such as the uracil-DNA glycosylase Afung . AF_1618's sequence homology to other archaeal proteins may hint at analogous roles in nucleic acid metabolism.

  • Protein Interactions: AF_1618 is listed as interacting with other proteins in pathways, though specific partners are unspecified in available data .

Research Applications

Recombinant AF_1618 is primarily used for:

  • Structural Studies: Its thermophilic origin makes it a candidate for high-resolution structural analysis under extreme conditions.

  • Enzyme Characterization: Potential use in assays to identify catalytic or binding activities, given its conserved domains.

  • Biophysical Analyses: Stability at high temperatures (given A. fulgidus's optimal growth at 83°C) enables studies of protein folding and extremophile adaptation.

Limitations and Future Directions

  • Uncharacterized Function: No peer-reviewed studies directly investigating AF_1618’s biological role were identified. Current data rely on vendor specifications and sequence homology .

  • Thermostability: The protein’s resilience to high temperatures warrants exploration for industrial enzyme engineering .

  • Comparative Genomics: Further studies could leverage A. fulgidus’s fully sequenced genome to identify conserved operons or regulatory elements linked to AF_1618 .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, please indicate them in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AF_1618; Uncharacterized protein AF_1618
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1618
Target Protein Sequence
MVEALILGWNPEYEPLKGWILNAAVTTKIFIDIFIGVWAFILAVVWVYWIERRPGEKVEK VEIWYRFPKFVIGYFLTFVIVAWLTSAAINAYAASLGVSVSELTTEQFKAAYAPFSAAVN EMNSLRRIFFALTFFSIGVISDFSVLRKEGLGRLALVYFVCLFGFIIWIGLAISYLFFHD VHLLFLK
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1618

STRING: 224325.AF1618

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why study its uncharacterized proteins?

Archaeoglobus fulgidus is a hyperthermophilic archaeon that has been extensively studied for its ability to thrive in extreme environments. Studying its uncharacterized proteins, including AF_1618, provides valuable insights into archaeal biology, evolutionary relationships, and potential biotechnological applications. Methodologically, researchers should begin by consulting whole-genome microarray studies of A. fulgidus, which have shown that approximately 14% of its 2,410 open reading frames (ORFs) exhibit significant changes in transcript abundance during environmental stress responses . When approaching an uncharacterized protein like AF_1618, researchers should first analyze its genomic context, sequence conservation across species, and predicted structural features to establish foundational knowledge before moving to experimental characterization.

What bioinformatic approaches should be used for initial characterization of AF_1618?

Initial bioinformatic characterization of AF_1618 should follow a systematic analytical pipeline:

  • Sequence analysis: Perform multiple sequence alignments with homologous proteins using BLAST, HHpred, and specialized archaeal genomic databases to identify conserved domains and motifs.

  • Structural prediction: Generate tertiary structure predictions using AlphaFold2 or RoseTTAFold, followed by validation through molecular dynamics simulations optimized for thermostable proteins.

  • Genomic context analysis: Examine neighboring genes to identify potential operonic structures, as seen with the heat shock response genes in A. fulgidus (e.g., AF1298-AF1297-AF1296 operon) .

  • Promoter region analysis: Search for regulatory motifs similar to those identified in other A. fulgidus genes, such as the palindromic motif CTAAC-N5-GTTAG found in heat shock response genes .

  • Phylogenetic analysis: Construct evolutionary trees to understand relationships with characterized proteins from other archaea and potentially related bacterial homologs.

This systematic approach provides a foundation for experimental design and hypothesis generation regarding AF_1618's potential function.

How can we determine if AF_1618 is involved in heat shock response similar to other A. fulgidus proteins?

To investigate AF_1618's potential role in heat shock response, researchers should implement a multi-faceted approach based on methodologies used for other A. fulgidus proteins:

  • Transcriptomic profiling: Conduct whole-genome microarray or RNA-seq analysis under various temperature conditions (optimal growth temperature versus heat shock), comparing expression patterns of AF_1618 with known heat shock genes such as AF1298, AF1297 (Hsp20), and AF1296 (cdc48) .

  • Promoter binding studies: Express and purify HSR1 (AF1298 product) to test its binding to the AF_1618 promoter region using electrophoretic mobility shift assays (EMSA) and DNase I footprinting .

  • Regulatory motif analysis: Scan the AF_1618 promoter region for the palindromic motif CTAAC-N5-GTTAG identified in heat shock-regulated genes .

  • Protein-protein interaction studies: Perform co-immunoprecipitation or pull-down assays to identify interactions between AF_1618 and known heat shock proteins.

  • Gene knockout/knockdown: Develop CRISPR-Cas or antisense RNA approaches adapted for A. fulgidus to assess phenotypic changes under heat stress conditions when AF_1618 expression is altered.

The resulting data should be analyzed using statistical methods appropriate for time-series expression data, with biological replicates to ensure significance of observed changes.

What approaches can determine the DNA-binding properties of AF_1618 if it contains a helix-turn-helix motif?

If bioinformatic analyses predict that AF_1618 contains a helix-turn-helix DNA binding motif similar to HSR1 (AF1298), researchers should implement the following methodological workflow:

  • Structural confirmation: Perform circular dichroism (CD) spectroscopy under varying temperature and pH conditions to confirm the presence of alpha-helical structures consistent with helix-turn-helix motifs in thermophilic environments.

  • DNA binding specificity determination: Conduct systematic EMSAs using recombinant AF_1618 with various DNA fragments from the A. fulgidus genome, particularly focusing on promoter regions of genes with related functions .

  • DNase I footprinting: For DNA fragments showing positive EMSA results, perform DNase I footprinting to precisely identify binding sites, as was successfully done for HSR1 binding to AF1298 and AF1971 promoters .

  • Consensus sequence identification: Analyze protected regions to identify potential consensus motifs, comparing them with known archaeal regulatory elements.

  • Functional validation: Using reporter gene assays adapted for thermophilic conditions, confirm the regulatory impact of identified binding sites.

Data from these experiments should be presented in tables showing binding affinities (Kd values) and precise nucleotide positions of protected regions, using consistent significant digits and measurement uncertainties as recommended for scientific data presentation .

How can differential gene expression data be efficiently analyzed to place AF_1618 in a functional context?

For robust differential expression analysis involving AF_1618, researchers should follow this systematic analytical framework:

  • Experimental design: Set up time-course experiments with A. fulgidus cultures exposed to various stressors (heat shock, pH changes, metabolic alterations), collecting samples at multiple time points.

  • Data collection and quality control: Generate transcriptomic data using RNA-seq or microarray approaches, including at least three biological replicates per condition. Perform rigorous quality control following standardized protocols.

  • Data analysis pipeline:

Raw DataNormalizationStatistical TestingClusteringNetwork Analysis\text{Raw Data} \rightarrow \text{Normalization} \rightarrow \text{Statistical Testing} \rightarrow \text{Clustering} \rightarrow \text{Network Analysis}
  • Co-expression cluster identification: Group genes with similar expression patterns to AF_1618 using hierarchical clustering or k-means algorithms.

  • Gene Ontology (GO) enrichment: Analyze functional annotations of co-expressed genes to infer potential biological processes involving AF_1618.

  • Network construction: Build protein-protein interaction or gene regulatory networks centered on AF_1618 and its co-expressed genes.

The resulting data should be organized in tables following the structure below:

Table 1: Differential Expression of AF_1618 Under Various Stress Conditions

ConditionTime (min)Log2 Fold Changep-valueFDR-adjusted p-valueCo-expressed Genes
Heat shock (80°C)15X.XX ± 0.XX0.0XX0.0XXAF1298, AF1297...
Heat shock (80°C)30X.XX ± 0.XX0.0XX0.0XXAF2238, AF1971...
pH stress (pH 5.0)15X.XX ± 0.XX0.0XX0.0XXAF1451, AF1323...

This structured approach helps place AF_1618 in a functional context based on its expression patterns and regulatory relationships .

What purification strategy is most effective for obtaining active recombinant AF_1618 protein?

Based on successful purification of other A. fulgidus proteins, researchers should implement a multi-step purification strategy optimized for thermostable proteins:

  • Expression optimization: Test multiple expression vectors incorporating different fusion tags (His6, GST, MBP) to identify constructs with optimal solubility and yield.

  • Cell lysis: Perform lysis under anaerobic conditions with specialized buffers containing reducing agents and stabilizers appropriate for archaeal proteins.

  • Heat treatment: Exploit the thermostability of AF_1618 by including a heat step (65-75°C for 20-30 minutes) to precipitate E. coli host proteins while retaining the target protein in solution.

  • Chromatography sequence: Implement a three-stage purification:

    • Immobilized metal affinity chromatography (IMAC) for initial capture

    • Ion exchange chromatography for intermediate purification

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality assessment: Validate protein purity using SDS-PAGE and mass spectrometry, and assess structural integrity using circular dichroism under conditions mimicking the native archaeal environment.

Throughout purification, include stabilizing agents such as glycerol (10-20%) and reducing agents to maintain protein integrity. For activity assays, establish conditions that mimic the hyperthermophilic environment of A. fulgidus, including elevated temperatures (70-85°C) and appropriate salt concentrations .

What approaches can determine if AF_1618 functions within a protein complex?

To investigate potential protein complex formation involving AF_1618, researchers should employ complementary methodologies:

  • Co-immunoprecipitation (Co-IP): Develop antibodies against recombinant AF_1618 or use epitope-tagged versions for pull-down assays from A. fulgidus lysates, followed by mass spectrometry identification of interacting partners.

  • Bacterial two-hybrid assays: Adapt two-hybrid systems for heat-stable protein interactions, using thermostable reporter systems.

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): Analyze the solution behavior of purified AF_1618 to determine if it exists as a monomer or forms homo-oligomeric structures.

  • Cross-linking mass spectrometry: Perform protein cross-linking experiments followed by mass spectrometry analysis to identify spatial relationships between interacting proteins.

  • Cryo-electron microscopy: For stable complexes, utilize cryo-EM to determine structural arrangements.

If AF_1618 forms part of an operon like other A. fulgidus genes (e.g., the AF1298-AF1297-AF1296 operon), particular attention should be paid to potential interactions with proteins encoded by neighboring genes . Data from these experiments should be presented with appropriate statistical analysis, including binding affinities and stoichiometric ratios of complex components.

How should researchers analyze and interpret contradictory functional predictions for AF_1618?

When faced with contradictory functional predictions for AF_1618, researchers should implement a systematic resolution strategy:

  • Weight of evidence approach: Evaluate predictions based on:

    • Methodological robustness of each prediction tool

    • Consistency across multiple prediction platforms

    • Phylogenetic conservation patterns

    • Structural similarity to proteins of known function

  • Experimental validation hierarchy: Design experiments to specifically test competing hypotheses, prioritizing:

    • Direct biochemical assays of predicted activities

    • In vivo functional complementation studies

    • Structural studies to confirm or refute predicted functional motifs

  • Integrative analysis: Combine heterogeneous data types using Bayesian integration methods that account for the varying reliability of different prediction methods.

  • Documentation of conflicting evidence: Create a comprehensive table documenting contradictory predictions and the evidence supporting each:

Table 2: Evaluation of Conflicting Functional Predictions for AF_1618

Predicted FunctionPrediction MethodConfidence ScoreSupporting EvidenceContradicting EvidenceValidation Experiment
DNA-binding regulatorAlphaFold + DALI0.85HTH motif predictionLack of identified binding motifEMSA with promoter regions
Metabolic enzymeBLAST homology0.62Sequence similarity to dehydrogenaseMissing catalytic residuesEnzymatic activity assay
Stress response proteinCo-expression analysis0.78Upregulation during heat shockNo chaperone domains identifiedComplementation in deletion strain

This methodical approach ensures that researchers can navigate the challenges of functional assignment for uncharacterized proteins while maintaining scientific rigor .

What statistical methods are appropriate for analyzing AF_1618 expression data across different experimental conditions?

For robust statistical analysis of AF_1618 expression data, researchers should implement the following methodological framework:

  • Data preprocessing:

    • Normalization: Apply appropriate normalization methods (e.g., RPKM/FPKM for RNA-seq, quantile normalization for microarray data)

    • Transformation: Use log2 transformation to stabilize variance

    • Batch effect correction: Implement ComBat or similar algorithms if experiments span multiple batches

  • Statistical testing:

    • For two-condition comparisons: Apply t-tests with Benjamini-Hochberg false discovery rate (FDR) correction

    • For multiple conditions: Implement ANOVA followed by post-hoc tests (Tukey's HSD)

    • For time-course data: Use specialized methods like EDGE or timecourse package in R

  • Effect size calculation:

    • Calculate fold changes with confidence intervals

    • Implement Cohen's d or similar metrics to quantify effect magnitude

  • Visualization approaches:

    • Generate heat maps of expression changes across conditions

    • Create volcano plots highlighting statistical significance versus fold change

    • Develop expression profile plots for time-series data

  • Power analysis:

    • Calculate required sample sizes for detecting biologically relevant expression changes

    • Assess minimum detectable fold changes given experimental design

This statistical framework ensures that expression changes in AF_1618 can be confidently attributed to experimental manipulations rather than random variation, while maintaining appropriate control of type I and type II errors .

How can researchers determine if AF_1618 has DNA-binding regulatory functions similar to HSR1?

To investigate potential DNA-binding regulatory functions of AF_1618 similar to HSR1 (AF1298), researchers should implement this comprehensive workflow:

  • Comparative sequence analysis: Align AF_1618 with HSR1 and other archaeal transcriptional regulators to identify shared conserved domains, particularly helix-turn-helix motifs.

  • Structural modeling validation: Generate structural predictions of AF_1618's DNA-binding domain and compare with crystallographic data of related regulators.

  • DNA-binding assays: Conduct EMSAs with purified recombinant AF_1618 and genomic fragments, particularly:

    • Its own promoter region (to test for autoregulation)

    • Promoters of neighboring genes (potential operon regulation)

    • Promoters containing the CTAAC-N5-GTTAG palindromic motif identified in HSR1 binding sites

  • DNase I footprinting: For positive EMSA results, perform footprinting to precisely map binding sites and identify potential consensus sequences.

  • Reporter gene assays: Develop archaeal reporter systems to quantify transcriptional effects of AF_1618 binding to identified promoter regions.

  • In vivo validation: Create AF_1618 deletion or overexpression strains to assess global transcriptional impacts using RNA-seq.

Data should be analyzed to determine binding affinities (Kd values) and specific sequence recognition patterns, with comparison to known archaeal transcriptional regulators like HSR1 .

What methods should be used to investigate potential involvement of AF_1618 in stress response pathways?

To systematically investigate AF_1618's potential role in stress response pathways, researchers should implement an integrated experimental approach:

  • Stress-response transcriptomics:

    • Subject A. fulgidus cultures to various stressors (heat shock, oxidative stress, pH stress, nutrient limitation)

    • Monitor AF_1618 expression using RT-qPCR and RNA-seq

    • Compare expression patterns with known stress response genes (e.g., AF1298, AF1297, AF1296)

  • Promoter analysis:

    • Identify regulatory elements in the AF_1618 promoter

    • Test for binding of known stress-response regulators like HSR1

    • Search for the palindromic motif CTAAC-N5-GTTAG associated with heat shock regulation

  • Protein interaction network:

    • Perform pull-down assays using tagged AF_1618

    • Identify interaction partners using mass spectrometry

    • Map interactions with known stress response proteins

  • Phenotypic characterization:

    • Generate AF_1618 knockout or knockdown strains

    • Assess growth and survival under various stress conditions

    • Compare with wild-type and strains lacking known stress response genes

  • Biochemical characterization:

    • Test for chaperone activity, protease activity, or other stress-related functions

    • Perform thermal stability assays

    • Assess impact of stress conditions on protein structure and function

Results should be compiled in a comprehensive table showing fold changes in expression across different stress conditions, with appropriate statistical analysis and direct comparison to benchmark stress response genes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.