Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1633 (AF_1633)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_1633; Uncharacterized protein AF_1633
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1633
Target Protein Sequence
MIDMLKKGLEKTLKFFPRLEDLAEVFDPLHRGEAFASSPNPRSIERKYILNVPTLKAKSS VEKITDGQSYEILGQPTGFEISEVKTAEGEIKIRIDFVNNIFADVMKIMCNVGLVLMMVF AAFYFAGINPADNLNLEVQKWSEPAEKFWSDVKGIHSTGYSWFLQNPLDPENAILLSVTL LALTPVIGILLTIPRSTGALRVIFLVIAVEFVYAIFRVMMGGGPMGH
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1633

STRING: 224325.AF1633

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus AF_1633 protein?

Archaeoglobus fulgidus AF_1633 is a 227-amino acid protein classified as "uncharacterized," meaning its precise biological function has not yet been definitively established. The protein is encoded by the AF_1633 gene in the hyperthermophilic archaeon Archaeoglobus fulgidus, an organism known for its ability to thrive in extreme environments with temperatures up to 95°C. Sequence analysis suggests potential membrane association, which may indicate involvement in transport or signaling processes, though this requires experimental validation. The protein's expression in the native organism likely responds to specific environmental conditions, offering researchers an opportunity to investigate its regulation mechanisms.

What expression systems are most effective for producing recombinant AF_1633?

Based on current availability, E. coli has been successfully employed as an expression system for recombinant AF_1633 protein production. When designing expression strategies, researchers should consider that Archaeoglobus fulgidus is a hyperthermophilic archaeon with different codon usage patterns and folding requirements than mesophilic bacteria. For optimal expression in E. coli, codon optimization of the AF_1633 sequence may improve yield. Alternative expression systems worth exploring include archaeal hosts like Thermococcus kodakarensis or Sulfolobus solfataricus, which might provide more native-like post-translational modifications and folding environments. Expression conditions should be systematically optimized, testing variables such as induction temperature (potentially lower temperatures to improve solubility), inducer concentration, and duration to maximize yield while maintaining proper folding.

What are the optimal storage conditions for recombinant AF_1633 protein?

For maximum stability and activity preservation of recombinant AF_1633 protein, store the lyophilized powder at -20°C/-80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of activity. The recommended storage buffer consists of Tris/PBS-based buffer with 6-50% trehalose or glycerol at pH 8.0, which helps maintain protein stability during freeze-thaw processes. For long-term storage, reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol to a final concentration of 50% before aliquoting and storing at -20°C/-80°C. This approach minimizes freeze-thaw damage while maintaining protein integrity for extended periods.

What strategies can be employed to determine the biological function of AF_1633?

Determining the function of uncharacterized protein AF_1633 requires a multi-faceted approach. Begin with detailed bioinformatic analysis including sequence homology searches across multiple databases, domain identification, and phylogenetic analysis to place AF_1633 in evolutionary context with potential functional homologs. For experimental characterization, gene knockout or CRISPR-interference studies in Archaeoglobus fulgidus can reveal phenotypic changes, though this requires specialized tools for archaeal genetic manipulation. Protein interaction studies using pull-down assays, co-immunoprecipitation, or proximity labeling coupled with mass spectrometry can identify interaction partners, potentially revealing functional pathways. Structural studies (X-ray crystallography, cryo-EM, or NMR) can identify binding pockets or catalytic sites. Additionally, high-throughput substrate screening assays may identify potential enzymatic activities. Finally, heterologous expression in model organisms followed by localization studies can provide insights into cellular function. The integration of these approaches offers the best chance of functionally characterizing this protein.

How should researchers approach structural characterization of AF_1633?

Structural characterization of AF_1633 presents unique challenges due to its potential membrane association. A strategic approach would begin with secondary structure prediction software to identify transmembrane regions, followed by experimental verification through circular dichroism spectroscopy to determine alpha-helical, beta-sheet, and random coil content. For tertiary structure determination, researchers should consider:

  • X-ray crystallography: Optimize protein purification to obtain highly pure, homogeneous samples. Screen numerous crystallization conditions with and without stabilizing ligands. Consider using antibody fragments to stabilize flexible regions.

  • Cryo-electron microscopy: Particularly valuable if AF_1633 forms complexes or if crystallization proves challenging. Sample preparation should focus on achieving monodisperse protein distribution.

  • NMR spectroscopy: For specific domains or fragments, particularly soluble regions.

For membrane-associated regions, consider detergent-solubilized preparations or nanodiscs to maintain native-like environments. Computational approaches such as AlphaFold2 can provide initial structural models to guide experimental design. Cross-linking mass spectrometry can yield valuable distance constraints to validate structural models.

What expression and purification challenges might researchers encounter with AF_1633?

The recombinant expression and purification of AF_1633 presents several potential challenges that researchers should anticipate. First, as a protein from a hyperthermophilic archaeon, AF_1633 may exhibit poor folding efficiency in mesophilic expression hosts like E. coli, potentially leading to inclusion body formation. To address this, expression temperature optimization (typically lowering to 16-20°C) and co-expression with chaperones like GroEL/GroES may improve solubility. Second, the potential membrane association suggested by sequence analysis may necessitate detergent-based extraction and purification methods, requiring screening of multiple detergent types (e.g., DDM, CHAPS, Triton X-100) for optimal protein stability and activity. Third, potential proteolytic sensitivity might require protease inhibitor cocktails throughout purification. For purification, the His-tagged version allows for immobilized metal affinity chromatography (IMAC), but researchers should implement secondary purification steps such as size exclusion chromatography to achieve high purity. Finally, assessing protein quality through techniques like dynamic light scattering and thermal shift assays is crucial before proceeding to functional studies.

How can researchers design experiments to identify potential interaction partners of AF_1633?

Identifying interaction partners of AF_1633 requires a systematic experimental design that considers both the protein's potential membrane association and its hyperthermophilic origin. Begin with affinity purification-mass spectrometry approaches using His-tagged AF_1633 as bait in native Archaeoglobus fulgidus lysates prepared at physiologically relevant temperatures (around 80°C). Crosslinking experiments using bifunctional reagents like DSS or formaldehyde prior to cell lysis can capture transient interactions. For membrane interaction studies, consider proximity-dependent biotin identification (BioID) or APEX2 approaches, with the proximity labeling enzyme fused to AF_1633. Yeast two-hybrid screening may identify soluble interaction partners, while split-ubiquitin systems are preferable for membrane protein interactions. Validate identified interactions through reciprocal co-immunoprecipitation, FRET/BRET analysis, or surface plasmon resonance. For physiological relevance, perform interaction studies under varying conditions that mimic the extreme environment of Archaeoglobus fulgidus, including high temperature and varying redox states. Negative controls using unrelated proteins from the same organism are essential to filter out non-specific interactions.

What purification protocol would yield the highest purity AF_1633 for structural studies?

A high-resolution purification protocol for AF_1633 should begin with optimized cell lysis conditions, using either sonication or high-pressure homogenization in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors. If membrane association is confirmed, include 1% DDM or other suitable detergent for solubilization. The multi-step purification process should proceed as follows:

  • Immobilized Metal Affinity Chromatography (IMAC): Apply cleared lysate to a Ni-NTA column, wash extensively with buffer containing 20-40 mM imidazole to remove non-specific binding proteins, and elute with a gradient of 50-500 mM imidazole.

  • Size Exclusion Chromatography: Further purify IMAC eluate on a Superdex 200 column to separate monomeric protein from aggregates and other contaminants.

  • Ion Exchange Chromatography: Apply pooled SEC fractions to an anion exchange column (e.g., Q Sepharose) with a salt gradient from 50-500 mM NaCl for final polishing.

  • Optional tag removal: If the His-tag might interfere with structural studies, include a protease cleavage step (e.g., TEV protease) followed by reverse IMAC.

Throughout purification, monitor protein purity via SDS-PAGE and Western blotting. Assess homogeneity using dynamic light scattering and thermal stability using differential scanning fluorimetry. Final preparations should exceed 95% purity with minimal aggregation for successful structural studies.

What activity assays could be developed to characterize AF_1633 function?

Developing activity assays for an uncharacterized protein like AF_1633 requires a hypothesis-driven approach based on sequence analysis and predicted structural features. Since sequence analysis suggests potential membrane association, consider these functional assessment strategies:

  • Transport assays: If AF_1633 functions as a transporter, reconstitute the purified protein into liposomes loaded with fluorescent reporter molecules to measure substrate transport across membranes under varying conditions.

  • Binding assays: Employ thermal shift assays (differential scanning fluorimetry) with a library of potential ligands/substrates to identify compounds that stabilize the protein, indicating binding.

  • Enzymatic activity screens: Test for common enzymatic activities including hydrolase, transferase, or oxidoreductase functions using colorimetric or fluorescent substrate panels.

  • Electrophysiology: If channel activity is suspected, conduct patch-clamp analyses on reconstituted proteoliposomes or planar lipid bilayers containing AF_1633.

  • ATPase activity: Measure ATP hydrolysis using malachite green or luciferase-based assays if sequence suggests nucleotide-binding capacity.

Conduct all assays under temperature conditions relevant to A. fulgidus (70-85°C) with appropriate thermostable controls. Compare wild-type protein activity to that of site-directed mutants targeting predicted functional residues to validate mechanistic hypotheses.

How can researchers investigate post-translational modifications of AF_1633?

Investigation of post-translational modifications (PTMs) in AF_1633 requires a comprehensive analytical strategy tailored to the unique challenges of archaeal proteins. Begin with in silico prediction tools specifically designed for archaeal PTMs, focusing on archaeal-specific modifications like N-glycosylation, methylation, acetylation, and protein splicing. For experimental verification, employ high-resolution mass spectrometry techniques including:

  • Bottom-up proteomics: Digest purified AF_1633 with multiple proteases (trypsin, chymotrypsin, and Glu-C) to ensure comprehensive sequence coverage, then analyze by LC-MS/MS using higher-energy collisional dissociation (HCD) and electron-transfer dissociation (ETD) fragmentation to preserve labile modifications.

  • Top-down proteomics: Analyze intact AF_1633 by high-resolution MS to determine the exact molecular weight and heterogeneity pattern indicative of modifications.

  • Targeted PTM enrichment: For specific modification types, use enrichment strategies such as titanium dioxide for phosphopeptides or hydrazide chemistry for glycopeptides prior to MS analysis.

Compare native AF_1633 purified directly from Archaeoglobus fulgidus with recombinant protein expressed in E. coli to identify archaeal-specific modifications. Western blotting with PTM-specific antibodies can provide complementary validation for common modifications. Finally, site-directed mutagenesis of identified modification sites can reveal their functional significance.

What approaches can determine the subcellular localization of AF_1633 in Archaeoglobus fulgidus?

Determining the subcellular localization of AF_1633 in Archaeoglobus fulgidus requires specialized techniques adapted for archaeal cells under hyperthermophilic conditions. A comprehensive approach would include:

  • Immunolocalization: Generate specific antibodies against AF_1633 for immunogold electron microscopy or immunofluorescence microscopy. This requires careful fixation protocols optimized for archaeal cell walls and membranes, typically involving paraformaldehyde and glutaraldehyde combinations.

  • Fluorescent protein fusions: Create C- and N-terminal fusions of AF_1633 with thermostable fluorescent proteins (e.g., TagRFP-T or mCherry variants engineered for stability at high temperatures). Express these constructs in Archaeoglobus fulgidus using archaeal promoters and examine localization by confocal microscopy.

  • Cell fractionation: Separate archaeal cell components through differential centrifugation into membrane, cytosolic, and other fractions, then detect AF_1633 by Western blotting in each fraction.

  • Protease protection assays: For membrane proteins, determine topology by treating intact cells or spheroplasts with proteases, then analyzing which protein regions are protected from degradation.

  • Proximity-dependent labeling: Express AF_1633 fused to enzymes like TurboID adapted for high temperature, allowing biotinylation of proximal proteins that can be identified by mass spectrometry.

These approaches should be conducted under controlled growth conditions relevant to AF_1633 expression, potentially including different growth phases and stress conditions.

How should researchers interpret sequence homology results for AF_1633?

Interpreting sequence homology results for an uncharacterized protein like AF_1633 requires a structured analytical approach that goes beyond basic BLAST searches. Begin with iterative sequence searching tools like PSI-BLAST and HMMER to detect remote homologs that might not appear in standard searches. When analyzing results, consider these critical factors:

  • E-value interpretation: For archaeal proteins, traditional E-value thresholds may need adjustment; consider homologs with E-values <1e-3 as potentially significant if they show consistent domain architecture.

  • Domain analysis: Use tools like InterPro, SMART, and Pfam to identify conserved domains, focusing on partial matches that might indicate divergent but functionally related domains.

  • Structural homology: Employ structure prediction tools like AlphaFold and HHpred to identify structural similarities that may persist despite sequence divergence.

  • Taxonomic distribution: Analyze the evolutionary pattern of homologs across species, particularly noting conservation patterns within Archaea versus broader distribution.

  • Contextual analysis: Examine genomic context of homologs, as conserved operonic structures often indicate functional relationships.

  • Integrative scoring: Develop a weighted scoring system that incorporates sequence similarity, domain architecture, and genomic context to prioritize functional hypotheses.

Document both positive and negative results thoroughly, as the absence of homology in certain databases can be as informative as positive findings, potentially indicating a novel protein family.

What statistical approaches are appropriate for analyzing AF_1633 interaction data?

Analyzing protein interaction data for AF_1633 requires robust statistical frameworks to distinguish true interactions from background noise. For affinity purification-mass spectrometry (AP-MS) data, implement Significance Analysis of INTeractome (SAINT) or Comparative Proteomic Analysis Software Suite (CompPASS), which compare bait-prey interactions against appropriate controls. Calculate confidence scores based on spectral counts, peptide intensity, and reproducibility across replicates. For protein-protein interactions, employ at least 3-4 biological replicates to ensure statistical power.

When analyzing yeast two-hybrid or split-ubiquitin data, use statistical frameworks that account for auto-activation rates and incorporate growth metrics across multiple selection conditions. For high-throughput binding assays, implement dose-response curves and calculate binding constants using non-linear regression models with appropriate correction for non-specific binding.

Network analysis should employ clustering algorithms (e.g., Markov Clustering) to identify functional complexes, supplemented by Gene Ontology enrichment analysis to identify overrepresented biological processes. Additionally, permutation-based methods can establish significance thresholds for network properties. For all analyses, calculate false discovery rates using the Benjamini-Hochberg procedure and implement appropriate corrections for multiple hypothesis testing to minimize false positives while maintaining sensitivity for detecting true interactions.

How can researchers resolve conflicting experimental results regarding AF_1633 function?

Resolving conflicting experimental results for AF_1633 requires a systematic troubleshooting approach and methodological cross-validation. First, implement a comprehensive experimental documentation system that captures all variables, including protein preparation methods, buffer compositions, and environmental conditions (especially temperature and pH relevant to Archaeoglobus fulgidus physiology). When faced with contradictory findings:

  • Assess methodological differences: Compare protein purification protocols, focusing on detergent types, buffer compositions, and presence of stabilizing agents that might affect protein conformation and activity.

  • Evaluate protein quality: Conflicting results often stem from variable protein preparations. Implement rigorous quality checks including size exclusion chromatography profiles, dynamic light scattering, thermal stability assays, and circular dichroism to ensure consistent secondary structure.

  • Cross-validate using orthogonal techniques: If one functional assay yields contradictory results, confirm with methodologically distinct approaches. For instance, validate binding interactions observed in pull-down assays with surface plasmon resonance or microscale thermophoresis.

  • Consider physiologically relevant conditions: Test function under conditions mimicking the native environment (80-85°C, appropriate pH and salt concentration) versus standard laboratory conditions.

  • Implement statistical rigor: Increase replicate numbers and perform power analysis to ensure sufficient statistical power to detect effects reliably.

  • Organize collaborative validation: Arrange for independent laboratories to reproduce key findings using standardized protocols and reagents.

Document all attempts at reconciliation, as patterns of reproducibility failure can themselves provide insights into protein behavior and experimental variables affecting function.

What bioinformatic tools are most effective for predicting AF_1633 structure-function relationships?

For predicting structure-function relationships of AF_1633, researchers should implement a multi-layered bioinformatic analysis pipeline that integrates evolutionary information with structural predictions. Begin with sequence-based tools including:

  • AlphaFold2/RoseTTAFold: These AI-based structure prediction tools have revolutionized protein structure prediction and work well even for proteins with few homologs, generating confidence metrics for different regions.

  • ConSurf/Evolutionary Trace: Map conservation patterns onto predicted structures to identify functionally important residues, adapting parameters for archaeal sequence divergence patterns.

  • 3DLigandSite/COACH: Predict potential ligand binding sites based on structural homology and physicochemical properties.

  • TMHMM/TOPCONS: Specifically analyze transmembrane topology, critical if AF_1633 is membrane-associated.

  • FTMap/SiteMap: Identify potential functional sites through computational solvent mapping.

  • DynaMut/LARMD: Analyze protein dynamics and flexibility to identify regions potentially involved in conformational changes.

  • Molecular docking: Screen potential ligands against predicted binding pockets using AutoDock Vina or similar tools.

The most effective approach combines these predictions with experimental validation through site-directed mutagenesis of predicted functional residues. When interpreting results, prioritize regions where multiple independent methods converge on the same prediction and consider archaeal-specific structural features that might not be well-represented in training datasets for general prediction algorithms.

What are the current knowledge gaps regarding AF_1633 and priority research directions?

Current knowledge of AF_1633 remains limited, with significant gaps in understanding its biological function, structure, interaction network, and regulation in Archaeoglobus fulgidus. The protein's classification as "uncharacterized" underscores the need for fundamental characterization studies. Priority research directions should include: (1) comprehensive structural determination using techniques like X-ray crystallography or cryo-EM; (2) functional characterization through targeted assays guided by structural predictions and sequence analysis; (3) investigation of interaction partners to place AF_1633 in biological context; (4) expression analysis under varying environmental conditions to understand regulation; and (5) evolutionary analysis to identify conserved features across archaea. Additionally, developing genetics tools for Archaeoglobus fulgidus would enable in vivo studies including knockout experiments to observe phenotypic effects. Collaborative approaches combining expertise in archaeal biology, structural biology, and bioinformatics offer the most promising path forward. Understanding AF_1633 may provide insights into archaeal membrane biology and potentially reveal novel protein families with unique properties relevant to extremophile adaptation.

How can researchers contribute their findings on AF_1633 to the scientific community?

Researchers investigating AF_1633 should prioritize comprehensive data sharing through multiple channels to advance collective understanding of this uncharacterized protein. Begin by publishing results in open-access journals with robust supplementary data sections, ensuring all experimental protocols are described with sufficient detail for reproduction. Deposit structural data in the Protein Data Bank (PDB) with accompanying validation reports, raw diffraction or microscopy data, and refinement statistics. Submit sequence annotations to UniProt and InterPro, providing evidence codes for functional predictions. For interaction data, utilize the IntAct or BioGRID databases with standardized reporting of confidence scores and experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.