Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1654 (AF_1654)

Shipped with Ice Packs
In Stock

Description

Biological Context and Genomic Background

Archaeoglobus fulgidus represents a fascinating hyperthermophilic sulfate-reducing archaeon first isolated from marine hydrothermal systems and deep oil fields, with some strains demonstrating remarkable adaptation to extreme environments . The complete genome sequencing of multiple A. fulgidus strains has revealed approximately 2.3 Mbp of genetic material encoding numerous proteins involved in specialized metabolic pathways that facilitate survival under extreme conditions . The AF_1654 gene is part of the core Archaeoglobus genome, being conserved across different strains with approximately 93.5% sequence identity between strain variations . Genomic analyses have positioned AF_1654 in proximity to genes involved in specialized cellular functions, suggesting potential involvement in critical biological processes unique to this archaeal lineage. The protein appears to be encoded within an operon structure alongside other functional proteins, potentially indicating coordinated expression with neighboring genes that contribute to related cellular functions . Understanding the genomic context of AF_1654 provides crucial background for investigating its biological significance within the distinctive physiology of A. fulgidus.

Archaeoglobus fulgidus as a Model Organism

A. fulgidus serves as an important model organism for studying archaeal biology, particularly for understanding adaptation to extreme environments. This sulfate-reducing archaeon grows at temperatures ranging from 60-95°C, with optimal growth occurring around 83°C, and can thrive under both heterotrophic and chemolithoautotrophic conditions . The organism utilizes sulfate or thiosulfate as electron acceptors in its energy metabolism, producing hydrogen sulfide as a byproduct. A. fulgidus strain 7324, originally isolated from deep oil fields, differs from the type strain VC16 by possessing additional genetic elements including extra CRISPR systems, mobile genetic elements, and numerous hypothetical gene functions that contribute to its adaptive capabilities . The genomic analysis of A. fulgidus has identified approximately 1001 core genes shared across Archaeoglobus species, with AF_1654 being among these conserved elements, suggesting its fundamental importance to archaeal physiology . This conservation across strains from diverse environments highlights the potential significance of AF_1654 in the core biological processes of this extremophilic archaeon.

Transmembrane Structure and Folding Properties

Analysis of the AF_1654 sequence reveals features characteristic of transmembrane proteins, with hydrophobic segments that likely facilitate membrane insertion and anchoring. Research on protein folding mechanisms has identified a significant Pro residue in the center of the third transmembrane helix that may play a crucial role in proper protein folding by specifically disfavoring misfolded structural conformations . This proline residue appears to function as a "negative folding determinant" that prevents the formation of off-pathway structures, representing an evolved mechanism to ensure proper protein folding in the challenging environment of archaeal membranes . This characteristic is particularly significant in the context of hyperthermophilic organisms like A. fulgidus, which must maintain protein stability at extremely high temperatures. The protein's sequence characteristics suggest it may possess structural features that contribute to exceptional thermostability, a property commonly observed in proteins from extremophilic archaea. These structural adaptations, including increased hydrophobic interactions, ion pairs, and compact folding, likely enable AF_1654 to maintain functional conformation even under the extreme conditions where A. fulgidus naturally thrives.

Expression and Purification Methods

Recombinant production of AF_1654 typically involves heterologous expression in Escherichia coli systems optimized for archaeal protein production. The full-length protein (residues 1-329) is commonly expressed with an N-terminal histidine tag to facilitate purification through affinity chromatography methods . Standard expression protocols utilize IPTG induction in bacterial culture media such as 2× YT, followed by cell harvesting and lysis procedures adapted to preserve protein integrity. The recombinant protein can be efficiently purified using nickel affinity chromatography, taking advantage of the histidine tag's affinity for metal ions, followed by size exclusion chromatography to achieve high purity levels exceeding 90% as confirmed by SDS-PAGE analysis . Purified AF_1654 is typically prepared as a lyophilized powder and should be reconstituted in deionized sterile water to concentrations between 0.1-1.0 mg/mL for experimental applications. For long-term storage, the addition of 5-50% glycerol (with 50% being optimal) and aliquoting for storage at -20°C/-80°C is recommended to maintain protein stability and prevent degradation during freeze-thaw cycles . Additionally, working aliquots can be stored at 4°C for up to one week to facilitate ongoing experimental procedures.

Functional Insights and Recent Research Findings

Despite its "uncharacterized" designation, emerging research offers intriguing clues about potential functional roles of AF_1654. Recent studies have implicated AF_1654 in protein-protein interactions that may be critical for archaeal cellular functions under extreme conditions. One significant research finding comes from studies on the Archaeoglobus fulgidus Argonaute (AfAgo) protein, which revealed that AfAgo forms a heterodimeric complex with an upstream-encoded protein in the same operon . While not explicitly identified as AF_1654, this research highlights the complex protein interaction networks in Archaeoglobus fulgidus that may involve AF_1654. The uncharacterized protein has also been identified in environmental proteomics studies, including analysis of leachate from composting processes, suggesting its stability and detectability even in complex biological matrices . This environmental persistence may indicate structural robustness consistent with proteins from extremophilic archaea. Sequence analysis suggests potential membrane-associated functions, possibly in transport, signaling, or metabolism, reflecting adaptation to the extreme environments inhabited by A. fulgidus.

Potential Involvement in Protein-Protein Interactions

Sequence analysis and preliminary functional studies suggest AF_1654 may participate in protein interaction networks important for survival under extreme conditions. The protein contains sequence motifs potentially involved in protein-protein recognition and binding, suggesting it might function within multiprotein complexes rather than as an isolated entity. Recent research on archaeal proteins has highlighted the importance of cooperative protein interactions in maintaining cellular functions under extreme thermal conditions, with many proteins forming higher-order complexes that enhance thermostability . The identification of AF_1654 in proteomics analyses of environmental samples containing extremophilic organisms provides circumstantial evidence for its stability and potential functional significance in challenging environments . When considered in the context of A. fulgidus biology, these characteristics suggest possible roles in membrane-associated processes, cellular adaptation mechanisms, or specific metabolic pathways unique to archaeal physiology. The relative conservation of AF_1654 across Archaeoglobus species further supports its functional importance, though the precise nature of its cellular role remains to be conclusively established through targeted functional studies.

Comparison with Related Archaeal Proteins

Comparative analysis of AF_1654 with other archaeal proteins provides valuable context for understanding its potential functions and evolutionary relationships. The table below summarizes key similarities and differences between AF_1654 and other well-characterized proteins from A. fulgidus and related archaeal species:

ProteinOrganismLength (aa)Known/Predicted FunctionSequence Similarity to AF_1654Reference
AF_1654A. fulgidus329Uncharacterized; possible membrane protein100% (self)
AFL (Lipase)A. fulgidus~330Alkalohyperthermophilic lipaseLow (~15%)
AfAgoA. fulgidusVariablePart of Argonaute complex; nucleic acid bindingUndetermined
MID-PIWI domainsA. fulgidusVariableCatalytically inactive PIWI domainsUndetermined
Core Archaeoglobus proteinsArchaeoglobus spp.VariableVarious essential functionsVariable (part of 1001 core genes)

The comparison reveals that while AF_1654 shares the extremophilic origin with other A. fulgidus proteins, it has limited sequence homology with functionally characterized proteins such as the AFL lipase. This limited homology suggests AF_1654 likely serves a distinct cellular function rather than performing roles redundant with other characterized archaeal proteins. The conservation of AF_1654 within the core genome of Archaeoglobus species indicates evolutionary pressure to maintain this protein, further supporting its functional importance despite the current lack of definitive functional characterization . These comparative analyses provide a foundation for directed experimental approaches to elucidate the specific cellular roles of this intriguing uncharacterized protein.

Applications in Research and Biotechnology

Recombinant AF_1654 has emerging applications in research and potentially in biotechnology, stemming from the unique properties associated with proteins from extremophilic archaea. The thermostability and potential membrane-associated functions of AF_1654 make it valuable for studying protein folding mechanisms under extreme conditions, particularly the role of specific residues in preventing misfolded structures . As a protein from a hyperthermophilic organism, AF_1654 may serve as a model system for investigating protein adaptation to extreme environments, providing insights applicable to protein engineering and synthetic biology approaches. Commercial availability of recombinant AF_1654 from specialized biochemical suppliers allows researchers to conduct detailed structural and functional studies without the challenges of culturing extremophilic archaea . The protein's potential involvement in archaeal membrane functions makes it relevant for comparative studies of membrane biology across domains of life. Additionally, as research progresses, AF_1654 may find applications in biotechnological processes requiring stable proteins for high-temperature industrial applications, similar to other archaeal proteins that have been repurposed for biotechnology.

Experimental Tools and Techniques

Various experimental approaches can be employed to further characterize AF_1654 and expand its research applications. Protein crystallography and cryo-electron microscopy represent powerful methods for resolving the three-dimensional structure of AF_1654, potentially revealing functional domains and interaction surfaces that could clarify its cellular roles. Protein-protein interaction studies using techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling may identify binding partners and place AF_1654 within specific cellular pathways or complexes. Functional genomics approaches, including gene knockout or knockdown in native A. fulgidus (if technically feasible) or heterologous expression in model organisms, could provide insights into phenotypic effects associated with altered AF_1654 expression. Biochemical assays tailored to test specific hypothesized functions, such as transport activity, catalytic capabilities, or regulatory roles, may directly reveal the protein's primary functions. Computational methods including molecular dynamics simulations under varying temperature conditions may predict structural changes and stability features relevant to the protein's adaptation to extreme environments . These diverse experimental approaches collectively offer pathways toward comprehensive functional characterization of this currently enigmatic archaeal protein.

Future Research Directions

Despite recent advances, significant knowledge gaps remain regarding the structure, function, and biological significance of AF_1654. Several promising research directions could substantially advance understanding of this protein. First, high-resolution structural determination through X-ray crystallography or cryo-electron microscopy would provide critical insights into functional domains and potential interaction surfaces that could illuminate cellular roles. Second, targeted gene knockout or knockdown studies in A. fulgidus, while technically challenging due to the extremophilic nature of the organism, would offer direct evidence of the protein's physiological importance through phenotypic analysis. Third, comprehensive protein-protein interaction mapping using methods adapted for archaeal systems could position AF_1654 within specific cellular pathways or complexes. Fourth, heterologous expression in model organisms followed by phenotypic analysis might reveal gain-of-function effects indicating specific cellular activities. Fifth, specialized biochemical assays designed to test hypothesized functions in membrane processes, cellular signaling, or metabolism could directly demonstrate functional capabilities. Finally, evolutionary analyses comparing AF_1654 homologs across diverse archaeal species could reveal patterns of conservation and variation indicative of specific functional constraints acting on this protein through evolutionary time.

Challenges in Characterizing AF_1654

Several technical and conceptual challenges have impeded comprehensive characterization of AF_1654. The extreme growth conditions required by A. fulgidus (high temperature, anaerobic environment, specialized media) make conventional genetic manipulation techniques challenging to implement, limiting in vivo functional studies in the native organism. Heterologous expression systems may not fully recapitulate the extreme environmental conditions under which the protein naturally functions, potentially obscuring key aspects of its native activity. The apparent membrane association of AF_1654 presents challenges for structural studies, as membrane proteins are typically more difficult to crystallize than soluble proteins. The limited sequence homology to proteins of known function complicates functional prediction through comparative approaches, requiring more direct experimental evidence. The possible involvement of AF_1654 in protein complexes means that studying the isolated protein may not capture its full functional context, necessitating more complex experimental systems that can preserve these interactions. The potential requirement for archaeal-specific lipids, cofactors, or interaction partners for full functionality may further complicate functional characterization in heterologous systems. Addressing these challenges through innovative experimental approaches represents a critical priority for advancing understanding of this intriguing archaeal protein.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this serves as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_1654; Uncharacterized protein AF_1654
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1654
Target Protein Sequence
MNNFKLIVRKWYIPVLIISLITLVASAYALYWATIPETKETQISIRHYSALAYFSGGAEV KKDNPIWANGSFVTLPVYSYSLTPEYSGEFYFTTAPRGDITIETEAKIVYFYEVSDAPVW EKVYYAASNTSRGEIKTNFKINVTDLKSKINEAQNSFGVYLGKTGARIDVSVHYYGKITG KDVDETLSFKIPIDVQSTYYSFSTLNETRDFEMPSTRVVEVQKPLHMKVIPAALCTVSII FAGLSVVYRTKYSDVSSLEREIERVSWEKKLKEVSFARMPETNLEMVEVERFEDISKAAE ETFEHLFYDREKGVFFFIHGGVLYYCREK
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1654

STRING: 224325.AF1654

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant for studying AF_1654?

Archaeoglobus fulgidus is a hyperthermophilic, sulfate-reducing archaeon that belongs to the Archaeoglobi class of the Euryarchaeota phylum. This organism is particularly significant because:

  • It thrives in extreme environments with temperatures between 60-95°C, making its proteins structurally stable at high temperatures

  • The strain ATCC 49558 / VC-16 / DSM 4304 (from which AF_1654 is derived) was isolated from marine hydrothermal vents

  • Its genome has been fully sequenced, providing comprehensive genomic context for studying uncharacterized proteins

  • It represents an important model organism for studying archaeal biology and evolution

For researchers working with AF_1654, understanding the native environment and physiological characteristics of A. fulgidus is crucial for optimal expression, purification, and functional characterization of this protein.

What methodologies are used for recombinant expression of AF_1654?

The recombinant expression of AF_1654 involves several methodological approaches:

  • Expression System Selection: While multiple expression systems are available, E. coli-based systems are most commonly used for initial characterization due to their simplicity and cost-effectiveness . For proteins from hyperthermophilic archaea, specialized strains like BL21(DE3), Rosetta-GAMI, or similar derivatives are preferred to address codon bias issues .

  • Vector Design: Plasmid construction typically involves:

    • Cloning the AF_1654 gene into expression vectors (pET-11a, pET-24a, or similar)

    • Adding fusion tags (His-tag, MBP, GST) to facilitate purification and solubility

    • Including appropriate promoters (T7 promoter is common for archaeal proteins)

  • Optimization Parameters:

ParameterOptimization ApproachRationale
TemperatureLower expression temperature (16-30°C)Reduces aggregation despite organism's thermophilic nature
InductionLow IPTG concentration (0.1-0.5 mM)Controls expression rate to improve folding
MediaRich media with supplements (e.g., trace metals)Provides necessary cofactors
Co-expressionChaperone co-expressionAids proper folding of archaeal proteins
  • Purification Strategy: A typical workflow includes:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Further purification by ion exchange chromatography

    • Final polishing by size exclusion chromatography

    • Special consideration for buffer conditions (pH, salt concentration) to maintain stability

The recommended storage conditions for purified AF_1654 include Tris-based buffer with 50% glycerol at -20°C, with avoidance of repeated freeze-thaw cycles .

What basic structural predictions can be made about AF_1654 based on sequence analysis?

While the three-dimensional structure of AF_1654 remains undetermined, several structural predictions can be made through computational analysis:

  • Transmembrane Domain Analysis:

    • Analysis of the hydrophobicity profile suggests AF_1654 contains transmembrane domains, particularly in its N-terminal region (approximately residues 10-30)

    • Tools like DeepTMHMM, which have been applied to similar archaeal proteins, would predict membrane localization

  • Secondary Structure Prediction:

    • The sequence features suggest a mix of alpha-helical and beta-sheet elements

    • The C-terminal region (approximately residues 278-329) contains a motif resembling a hydrolase domain based on the presence of the GxxxHGG pattern

  • Domain Identification:

    • Homology detection using HHsearch and FoldSeek might reveal distant structural relationships with characterized proteins

    • Potential functional domains could be identified through conserved sequence motifs

  • Protein Family Classification:

    • Presence of the sequence motif "GVFFFIHGG" near the C-terminus suggests potential enzymatic activity, possibly related to hydrolases

    • Alignment with proteins of known structure would identify conserved residues that might be involved in catalysis or substrate binding

These predictions provide a starting point for targeted experimental approaches, including site-directed mutagenesis of predicted functional residues.

What experimental approaches are most effective for determining the function of uncharacterized proteins like AF_1654?

Determining the function of uncharacterized proteins like AF_1654 requires a multi-faceted approach:

  • Genomic Context Analysis:

    • Examine neighboring genes in the A. fulgidus genome

    • Identify potential operonic structures that might suggest functional relationships

    • Compare with syntenic regions in related archaeal species

  • Integrated Biochemical Characterization:

    • Substrate screening panels testing various metabolites and cofactors

    • Activity-based protein profiling using chemical probes

    • Metabolomics approaches comparing wild-type and knockout/overexpression strains

  • Structural Biology Approaches:

    • X-ray crystallography to determine three-dimensional structure

    • NMR spectroscopy for smaller domains or the full protein

    • Cryo-EM for larger complexes if AF_1654 forms multimeric assemblies

  • Protein-Protein Interaction Studies:

    • Pull-down assays using tagged AF_1654 to identify binding partners

    • Yeast two-hybrid or bacterial two-hybrid systems adapted for archaeal proteins

    • In vivo cross-linking followed by mass spectrometry to identify transient interactions

  • Comparative Genomics Workflow:

StepMethodExpected Outcome
1BLAST search against RefSeq databaseIdentify homologs in other species
2Multiple sequence alignment using MAFFTIdentify conserved residues
3Phylogenetic analysisDetermine evolutionary relationships
4Functional prediction using AlphaFold modelsGenerate structural predictions

This integrated approach has been successfully applied to characterize other archaeal proteins, such as the Archaeoglobus fulgidus Argonaute protein described in search result , which was initially uncharacterized but later found to form a heterodimeric complex with another protein.

How can researchers address challenges specific to expressing and characterizing recombinant proteins from hyperthermophilic archaea?

Working with proteins from hyperthermophilic archaea like A. fulgidus presents unique challenges that require specialized approaches:

  • Expression Optimization for Thermostable Proteins:

    • Challenge: Hyperthermophilic proteins may fold incorrectly at mesophilic temperatures

    • Solution: Implement cold-shock expression systems or use archaeal host strains

    • Methodology: Express at lower temperatures (16-25°C) for extended periods (24-72 hours) rather than standard conditions

  • Solubility Enhancement Strategies:

    • Challenge: Archaeal membrane proteins often form inclusion bodies

    • Solution: Fusion with solubility tags (MBP, SUMO, NusA) or specialized refolding protocols

    • Protocol Example: Inclusion body isolation followed by denaturation in 8M urea and stepwise dialysis for refolding

  • Buffer System Development:

    • Challenge: Standard buffers may not maintain archaeal protein stability

    • Solution: Use buffers that mimic physiological conditions of A. fulgidus

    • Recommended Buffers: 50 mM PIPES (pH 6.8-7.0), 300-500 mM NaCl, with divalent cations (Mg2+, Mn2+)

  • Activity Assay Considerations:

    • Challenge: Standard assay conditions may not reflect optimal conditions for archaeal enzymes

    • Solution: Perform assays at elevated temperatures (60-85°C) under anaerobic conditions

    • Equipment: Use sealed pressure tubes or specialized high-temperature reactors

  • Protein Stability Assessment:

    • Challenge: Traditional stability assays may underestimate archaeal protein stability

    • Solution: Differential scanning calorimetry (DSC) with extended temperature ranges

    • Expected Results: Melting temperatures (Tm) often exceed 80°C for A. fulgidus proteins

The successful characterization of other A. fulgidus proteins, such as RadA (involved in homologous recombination), demonstrates that these challenges can be overcome with appropriate methodological adaptations .

What bioinformatic approaches can effectively predict the function of AF_1654?

Advanced bioinformatic approaches can provide crucial insights into the potential function of AF_1654:

  • Integrative Sequence-Structure-Function Prediction Pipeline:

StepComputational MethodPurpose
1PSI-BLAST and HHpredIdentify remote homologs
2AlphaFold2 or RoseTTAFoldGenerate structural models
3FoldSeek and DaliIdentify structural homologs
4ConSurfMap evolutionary conservation onto structure
53DLigandSitePredict ligand binding sites
6COACH-DPredict enzyme active sites
  • Comparative Genomics Approaches:

    • Phylogenetic profiling to identify co-evolving genes

    • Gene neighborhood analysis to identify functionally related genes

    • Analysis of presence/absence patterns across diverse archaea

  • Machine Learning-Based Function Prediction:

    • Train models on known archaeal protein functions

    • Use sequence features, predicted structural properties, and genomic context as features

    • Apply ensemble methods for robust prediction

  • Metagenomic Data Mining:

    • Search environmental metagenomes from extreme environments

    • Identify natural variants of AF_1654 to infer functional constraints

    • Analyze expression patterns in different environmental conditions

Similar approaches were successfully used for characterizing the function of AfAgo, which was initially classified as a truncated long-B pAgo containing only MID and catalytically inactive PIWI domains, but later found to form heterodimeric complexes that affect its function in DNA binding .

How can structural biology techniques be optimized for determining the structure of AF_1654?

Determining the structure of AF_1654 requires optimization of several structural biology techniques:

  • X-ray Crystallography Optimization:

    • Crystallization screening: Employ sparse matrix screens specifically designed for membrane or archaeal proteins

    • Additive screening: Include lipids, detergents, and small molecules to stabilize protein conformation

    • Crystal optimization: Use techniques like seeding, vapor diffusion, and temperature control

    • Data collection: Collect at synchrotron sources like EMBL P13 and P14 beamlines at PETRA III

    As demonstrated with other archaeal proteins, phase determination can be achieved through molecular replacement using homologous structures or experimental phasing methods .

  • Cryo-EM Approach:

    • Sample preparation: Optimize vitrification conditions for thermophilic proteins

    • Imaging parameters: Use specific defocus ranges and exposure settings for smaller proteins

    • Data processing: Apply 2D classification to identify homogeneous populations

    • Model building: Integrate with AlphaFold predictions for improved modeling

  • NMR Spectroscopy Strategy:

    • Sample preparation: Express AF_1654 with 15N and 13C labels

    • Experiment selection: Use TROSY-based experiments for improved signal quality

    • Data analysis: Apply automated structure calculation with manual refinement

  • Integrated Structural Analysis Workflow:

These approaches have been successfully applied to other A. fulgidus proteins, notably the AfFtn K150A/R151A mutant, which was crystallized and its structure solved to reveal how specific amino acid substitutions altered the symmetry of the protein assembly .

What methodologies are most effective for studying potential protein-protein interactions involving AF_1654?

Studying protein-protein interactions involving AF_1654 requires specialized approaches:

  • Pull-down Assays Optimized for Archaeal Proteins:

    • Use thermostable affinity tags that retain function at high temperatures

    • Perform binding reactions at elevated temperatures (50-60°C) to maintain native conformation

    • Include appropriate controls for non-specific binding, which may differ from mesophilic systems

  • Crosslinking Mass Spectrometry (XL-MS) Workflow:

    • Apply thermostable crosslinkers (e.g., modified BS3 or DSS derivatives)

    • Optimize crosslinking conditions for thermophilic proteins (higher temperatures, specialized buffers)

    • Use specialized search algorithms that account for archaeal protein sequences

  • Surface Plasmon Resonance (SPR) Adaptations:

    • Modify running buffers to maintain protein stability

    • Use temperature-controlled systems capable of operating at 50-60°C

    • Apply regeneration conditions optimized for thermostable proteins

  • Bacterial/Archaeal Two-Hybrid Systems:

    • Adapt existing bacterial two-hybrid systems for archaeal proteins

    • Consider development of specialized archaeal expression hosts

    • Use thermostable reporter genes for functional readouts

  • Co-immunoprecipitation from Native Source:

    • Develop antibodies against AF_1654 or use epitope tagging in archaeal expression systems

    • Optimize lysis conditions to preserve native interactions

    • Use mass spectrometry to identify co-precipitated proteins

The successful characterization of the AfAgo protein complex demonstrates how such approaches can reveal unexpected interactions - in that case, showing that AfAgo forms a heterodimeric complex with another protein encoded in the same operon, significantly affecting its DNA-binding properties .

How can researchers design experiments to validate computational predictions about AF_1654 function?

Validating computational predictions about AF_1654 requires a systematic experimental approach:

  • Site-Directed Mutagenesis Validation Strategy:

    • Target predicted catalytic residues or binding sites identified through bioinformatics

    • Create alanine substitutions or conservative mutations of key residues

    • Assess effects on protein stability and activity using thermal shift assays and activity measurements

  • Domain Deletion and Chimeric Protein Analysis:

    • Create truncated variants based on predicted domain boundaries

    • Generate fusion proteins with domains of known function

    • Analyze changes in localization, interaction partners, and biochemical activities

  • Substrate Validation Protocol:

Prediction TypeValidation MethodControls
Enzymatic activityBiochemical assays with predicted substratesInactive mutants, related substrates
Binding partnerPull-down assays, SPR, ITCSpecificity controls, competition assays
Cellular localizationLocalization in heterologous systemsTruncation variants, targeting sequence mutations
  • Phenotypic Analysis in Model Systems:

    • Express AF_1654 in heterologous hosts like E. coli or yeast

    • Assess effects on growth, stress resistance, or specific metabolic pathways

    • Complement deletions of predicted orthologues in model organisms

  • Structural Validation of Predictions:

    • Compare experimental structures (if available) with computational models

    • Validate predicted binding sites using ligand docking and binding assays

    • Use hydrogen-deuterium exchange mass spectrometry to validate predicted dynamic regions

This approach was successfully used in the characterization of AfFtn, where the researchers tested the computational prediction that K150 and R151 residues played critical roles in the protein's unique assembly by creating a K150A/R151A double mutant, which indeed altered the symmetry type of the ferritin cage from tetrahedral to octahedral .

What comparative genomics approaches can identify AF_1654 orthologues and reveal evolutionary insights?

Identifying orthologues of AF_1654 and understanding its evolution requires sophisticated comparative genomics approaches:

  • Comprehensive Orthology Identification Pipeline:

    • Perform PSI-BLAST searches against diverse genomic databases

    • Apply reciprocal best hit methodology across archaeal genomes

    • Use sequence cluster analysis to identify potential orthologue groups

    • Validate orthology assignments using phylogenetic analysis and synteny conservation

  • Phylogenetic Analysis Methodology:

    • Collect a diverse set of AF_1654 homologs using BLAST against the NCBI RefSeq database

    • Reduce sequence redundancy by clustering homologs with >90% sequence identity

    • Generate multiple sequence alignments using accuracy-oriented MAFFT modes (L-INS-i)

    • Construct maximum likelihood phylogenetic trees with appropriate substitution models

  • Synteny and Genomic Context Analysis:

    • Examine gene neighborhoods across archaeal genomes

    • Identify conserved operonic structures that provide functional hints

    • Map genomic rearrangements to understand evolutionary dynamics

  • Selective Pressure Analysis:

    • Calculate dN/dS ratios to identify sites under selection

    • Apply codon-based likelihood models to detect episodic or diversifying selection

    • Correlate patterns of selection with structural features

  • Archaeal Pangenome Analysis:

Analysis ComponentMethodologyExpected Insight
Core genome analysisIdentify genes present across all Archaeoglobus speciesEssential functions
Accessory genome analysisMap presence/absence of AF_1654 homologsNiche-specific adaptations
Gene gain/loss modelingPhylogenetic birth-death modelsEvolutionary dynamics
Horizontal gene transfer detectionCompositional bias analysis, phylogenetic incongruenceGene acquisition mechanisms

This approach was successfully applied to the analysis of the A. fulgidus strain 7324 genome, which identified 1001 core Archaeoglobus genes and more than 2900 pan-genome orthologous genes .

What specialized techniques are required for functional characterization of potentially membrane-associated proteins like AF_1654?

The sequence characteristics of AF_1654 suggest it may be membrane-associated, requiring specialized techniques for functional characterization:

  • Membrane Localization Confirmation:

    • Cell fractionation studies with western blot analysis

    • Fluorescent protein fusions with confocal microscopy in heterologous systems

    • Protease protection assays to determine membrane topology

  • Membrane Protein Purification Strategies:

    • Screen multiple detergents (DDM, LDAO, Fos-choline-12) for optimal extraction

    • Apply amphipol or nanodisc reconstitution for stabilization

    • Use lipid cubic phase methods for structural studies

  • Biophysical Characterization Methods:

    • Circular dichroism spectroscopy optimized for membrane proteins

    • Microscale thermophoresis for ligand binding studies

    • Hydrogen-deuterium exchange mass spectrometry with specialized detergent compatibility

  • Functional Reconstitution Approaches:

    • Liposome reconstitution with archaeal lipid mixtures

    • Proteoliposome-based transport or activity assays

    • Planar lipid bilayer electrophysiology if channel/transport function is suspected

  • Specialized Structural Biology Techniques:

TechniqueApplication to AF_1654Expected Outcome
Solid-state NMRMembrane-embedded structural analysisSecondary structure in lipid environment
Electron crystallography2D crystals in lipid environmentMedium-resolution structure
Single-particle cryo-EMDetergent-solubilized or nanodisc samplesNear-atomic resolution structure
DEER spectroscopyDistance measurements between labeled residuesConformational dynamics
  • Computational Analyses for Membrane Proteins:

    • Transmembrane domain prediction using DeepTMHMM

    • Molecular dynamics simulations in explicit membrane environments

    • Prediction of lipid-binding sites and protein-membrane interactions

The successful characterization of other archaeal membrane proteins demonstrates the feasibility of these approaches when properly optimized for the unique properties of hyperthermophilic proteins from A. fulgidus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.