Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant AF_1792 is produced in two primary systems:

Table 1: Expression Systems Comparison

ParameterE. coli Mammalian Cells
HostEscherichia coliMammalian cell lines
Purity>90% (SDS-PAGE)>85% (SDS-PAGE)
FormLyophilized powderLiquid or lyophilized
Reconstitution BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Deionized sterile water with 5-50% glycerol
YieldNot specifiedNot specified

Purification typically employs affinity chromatography (e.g., Ni-NTA for His-tagged variants) followed by size-exclusion chromatography .

Functional Insights

While AF_1792 remains uncharacterized, genomic and transcriptomic studies suggest potential regulatory roles:

  • Heat Shock Response: AF_1792’s promoter region contains a putative HSR1 (AF1298) binding motif (CTAAC-N5-GTTAG), though its mRNA levels showed no significant change during heat shock in A. fulgidus .

  • Operon Context: AF_1792 is not part of any identified operon but lies near genes involved in stress response and metabolic regulation .

Table 2: Heat Shock-Regulated Genes with HSR1 Binding Sites

GeneHSR1 Binding SiteExpression During Heat Shock
AF1298PresentUpregulated
AF1971PresentUpregulated
AF1792PresentNo change

Applications and Research Implications

  • Structural Biology: Used in crystallization trials due to its thermostable nature .

  • Hypothesis-Driven Studies: Investigated for roles in DNA repair, ion transport, or redox metabolism, though no direct evidence exists .

Limitations and Future Directions

  • The lack of functional annotation limits mechanistic studies.

  • Comparative analyses with homologs in related archaea (e.g., Pyrococcus furiosus) are needed to infer potential roles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
AF_1792; Uncharacterized protein AF_1792
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1792
Target Protein Sequence
MLCISNIMLEKPNKGGIMRYGKIGVATAMAVGAAVGYAVESGKWFITVIAVLAGVALLSL VKRRVDEVVEDERTVRVGERASRRTVEIFSIGAALSGAVMLALDLHTEAALALEFAVCCV LVLYLIFYGYYSFRALD
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1792

STRING: 224325.AF1792

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant for protein research?

Archaeoglobus fulgidus is a hyperthermophilic euryarchaeon that has attracted significant research interest due to its unique biological properties and evolutionary significance. As a thermophilic organism, it thrives in extreme temperature environments, making its proteins particularly interesting for stability studies. A. fulgidus represents an important model organism for understanding archaeal biology, DNA repair mechanisms, and protein function under extreme conditions . The organism possesses specialized proteins that function optimally at high temperatures, which presents both challenges and opportunities for researchers studying its uncharacterized proteins like AF_1792. Understanding these proteins contributes to our knowledge of thermostable enzymes and archaeal metabolism, while potentially offering insights into early evolution on Earth.

What approaches should be used for initial characterization of AF_1792?

Initial characterization of AF_1792 should follow a systematic approach that begins with bioinformatic analysis and proceeds to experimental validation. Researchers should first conduct comprehensive sequence alignment with similar proteins from related species, domain prediction, and structural modeling. Based on the successful characterization methodology used for similar proteins like Afung, researchers should consider:

  • Cloning and expression of the AF_1792 gene using vectors like pBAD/HisA

  • Purification via affinity chromatography using techniques similar to those employed for Afung-His fusion proteins

  • Basic biochemical characterization including thermal stability assays, pH optimum determination, and substrate screening

  • Immunological characterization using polyclonal antibodies raised against the purified protein

This methodological pathway has proven effective for characterizing other A. fulgidus proteins and would likely yield valuable initial insights into AF_1792 function .

How is recombinant AF_1792 typically produced for research purposes?

Based on established protocols for similar A. fulgidus proteins, recombinant AF_1792 production would typically involve heterologous expression in a suitable host system. The recommended methodology includes:

  • Gene amplification from genomic A. fulgidus DNA using PCR with specific primers containing appropriate restriction sites

  • Cloning into an expression vector such as pBAD/HisA that allows for controlled expression and facilitates purification

  • Expression in a host system, with E. coli being commonly used despite potential folding challenges with archaeal proteins

  • Purification using affinity chromatography, typically employing a His-tag system with resins such as TALON Superflow

This approach mirrors successful expression strategies used for other A. fulgidus proteins like Afung, where researchers amplified the gene, verified correct sequence insertion, and produced a recombinant His-tagged fusion protein for subsequent purification and characterization .

What experimental approaches are most effective for determining the function of AF_1792?

Determining the function of an uncharacterized protein like AF_1792 requires a multi-faceted experimental approach that combines biochemical, genetic, and structural biology techniques. Based on successful strategies used for characterizing other A. fulgidus proteins, the following methodological pathway is recommended:

  • Activity screening assays against various substrates, with particular attention to DNA binding and modification activities given the prevalence of these functions in other A. fulgidus proteins

  • Immunodepletion studies using antibodies raised against recombinant AF_1792 to assess its contribution to specific cellular activities in A. fulgidus cell extracts

  • Complementation studies in model organisms with defined mutants lacking potentially homologous proteins

  • Protein-protein interaction studies using pull-down assays, yeast two-hybrid screening, or co-immunoprecipitation followed by mass spectrometry

This systematic approach has proven effective for functional determination of other A. fulgidus proteins, as demonstrated in the characterization of Afung as a principal DNA glycosylase enzyme .

How might AF_1792 relate to DNA repair mechanisms in Archaeoglobus fulgidus?

While specific information about AF_1792's role in DNA repair is not directly established in the available literature, methodological approaches to investigate this possibility can be derived from studies of other A. fulgidus proteins. A. fulgidus employs unique DNA repair mechanisms, including a base excision repair (BER) system that utilizes a β-elimination mechanism for incision of abasic sites following uracil removal .

To investigate AF_1792's potential involvement in DNA repair:

  • Conduct substrate specificity assays using defined DNA substrates containing various lesions, similar to the experiments performed with Afung using 5′-32P-labeled DNA sequences containing uracil

  • Perform immunodepletion experiments with anti-AF_1792 antibodies to determine if its removal affects DNA repair activities in cell extracts

  • Compare the catalytic properties of AF_1792 with known DNA repair enzymes like Afung, particularly examining inhibition patterns and substrate preferences

  • Assess potential interactions with established DNA repair pathway components through co-immunoprecipitation or pull-down assays

These methodological approaches can help establish whether AF_1792 participates in known DNA repair pathways or represents a novel repair function .

What challenges might researchers face when analyzing thermostability of AF_1792?

Analyzing the thermostability of AF_1792 presents several methodological challenges that researchers must address through careful experimental design:

  • Selection of appropriate buffer systems that maintain stability at elevated temperatures while avoiding interference with analytical techniques

  • Development of activity assays that function reliably across a wide temperature range, particularly at the high temperatures where A. fulgidus proteins typically exhibit optimal activity

  • Distinguishing between reversible and irreversible thermal denaturation through careful cooling and reheating experiments

  • Accounting for potential cofactor requirements that might influence thermal stability profiles

A particularly informative approach would involve comparative stability studies with homologous proteins from mesophilic organisms to identify specific adaptations contributing to thermostability. The analysis should consider not only temperature effects on activity but also structural stability through techniques like differential scanning calorimetry and circular dichroism at temperatures exceeding 80°C, where many A. fulgidus proteins remain functional .

What purification strategies are most effective for obtaining high-quality AF_1792 samples?

Based on successful purification protocols for similar A. fulgidus proteins, researchers should consider the following methodological approach for AF_1792 purification:

  • Expression with an affinity tag (preferably His-tag) to facilitate initial capture, with the expression vector design incorporating appropriate restriction sites for proper insertion

  • Heat treatment of crude lysates (70-80°C) as an initial purification step, exploiting the thermostability of A. fulgidus proteins to denature contaminating host proteins

  • Affinity chromatography using resins such as TALON Superflow, which has proven effective for related proteins

  • Size exclusion chromatography as a polishing step to achieve high purity

Table 1: Recommended Purification Protocol for Recombinant AF_1792

StepMethodConditionsExpected Outcome
1Cell lysisSonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerolRelease of soluble protein
2Heat treatment75°C for 20 minutesRemoval of thermolabile contaminants
3Affinity chromatographyTALON resin, elution with 250 mM imidazole>80% purity
4Size exclusionSuperdex 200 column>95% purity

This purification strategy is based on successful approaches used for other A. fulgidus proteins, particularly the Afung protein, which was effectively purified using similar methodology .

How can researchers effectively assess potential enzymatic activities of AF_1792?

Assessment of enzymatic activities for an uncharacterized protein like AF_1792 requires a comprehensive methodological approach:

  • Bioinformatic prediction of potential activities based on sequence homology, conserved domains, and structural modeling

  • Broad-spectrum activity screening against diverse substrate classes, including:

    • Nucleic acid modification activities (glycosylase, endonuclease, etc.)

    • Metabolic enzyme activities (dehydrogenase, transferase, etc.)

    • Protein modification activities (protease, kinase, etc.)

  • Design of specific activity assays based on initial screening results, incorporating:

    • Varied reaction conditions (temperature range 37-95°C, pH 5-9, various cofactors)

    • Multiple detection methods (spectrophotometric, radiometric, fluorometric)

    • Controls for non-specific activities

This approach mirrors the successful characterization strategy employed for Afung, where specific activities were assessed using radiolabeled substrates and gel-based assays to determine function .

What expression systems are optimal for producing functional recombinant AF_1792?

Selection of an appropriate expression system is critical for obtaining functional recombinant AF_1792. Based on experiences with similar archaeal proteins, researchers should consider:

  • E. coli expression systems with specialized features:

    • BL21(DE3) strains containing additional chaperones to aid proper folding

    • pBAD vectors allowing fine-tuned expression control through arabinose induction

    • Cold-shock promoters for slow expression at reduced temperatures to enhance folding

  • Yeast expression systems:

    • Pichia pastoris for proteins requiring eukaryotic folding machinery

    • Demonstrated success for production of other A. fulgidus proteins

  • Cell-free expression systems:

    • PURE system supplemented with archaeal chaperones

    • Allows rapid screening of folding conditions

Table 2: Comparison of Expression Systems for Recombinant AF_1792

Expression SystemAdvantagesDisadvantagesRecommended Conditions
E. coli BL21(DE3)High yield, simple manipulationPotential folding issues18°C expression, Terrific Broth medium
Yeast (P. pastoris)Better folding for complex proteinsLonger production timeMethanol induction, 30°C
Cell-free systemRapid, allows toxic proteinsLower yield, expensive37°C, supplemented with archaeal factors

The choice between these systems should be guided by initial small-scale expression trials, with protein functionality rather than yield being the primary selection criterion .

What structural analysis techniques are most informative for AF_1792 characterization?

Structural characterization of AF_1792 requires a combination of complementary techniques to provide comprehensive insights into its three-dimensional organization and functional elements:

Each technique has specific sample preparation requirements and limitations, so a multi-technique approach is recommended for comprehensive structural characterization of AF_1792.

How should researchers design experiments to identify potential binding partners of AF_1792?

Identification of binding partners is crucial for understanding the biological function of AF_1792. A methodological framework for this investigation should include:

  • Affinity purification-mass spectrometry (AP-MS):

    • Use His-tagged or epitope-tagged AF_1792 as bait

    • Perform pull-downs under various conditions including high temperature

    • Identify binding proteins through LC-MS/MS analysis

  • Yeast two-hybrid screening:

    • May require adaptation for thermophilic proteins

    • Can detect direct binary interactions

    • Consider using specialized thermophilic Y2H systems

  • Protein microarrays:

    • Custom arrays containing A. fulgidus proteins

    • Allows systematic screening for interactions

    • Can detect interactions with non-protein molecules

  • Crosslinking mass spectrometry:

    • Captures transient interactions in vivo

    • Provides structural information about the interaction interface

    • Compatible with thermophilic growth conditions

These complementary approaches can provide a comprehensive map of AF_1792's interactome, offering crucial insights into its biological function within the thermophilic cellular environment.

How should researchers interpret sequence homology data for AF_1792?

Interpreting sequence homology data for an uncharacterized protein like AF_1792 requires a systematic analytical approach that goes beyond simple BLAST searches:

  • Multiple sequence alignment with diverse homologs:

    • Include proteins from all three domains of life

    • Weight conservation patterns based on phylogenetic distance

    • Identify absolutely conserved residues as potential functional sites

  • Domain architecture analysis:

    • Map conserved domains and motifs

    • Compare domain organization with functionally characterized proteins

    • Identify potential catalytic residues or binding sites

  • Phylogenetic analysis:

    • Construct maximum likelihood trees

    • Map function onto phylogeny to identify patterns of functional divergence

    • Consider horizontal gene transfer events common in archaea

  • Integration with structural predictions:

    • Map conservation onto predicted 3D structures

    • Identify surface patches of high conservation

    • Correlate with potential active sites or binding interfaces

This comprehensive approach can provide significant insights into potential functions even in the absence of direct experimental data, as demonstrated by successful applications to other archaeal proteins .

What considerations should guide experimental design for thermostability comparisons between AF_1792 and mesophilic homologs?

Comparative thermostability studies between AF_1792 and mesophilic homologs require careful experimental design to generate meaningful data:

  • Selection of appropriate mesophilic homologs:

    • Choose proteins with significant sequence similarity (>30%)

    • Include representatives from different phylogenetic lineages

    • Consider proteins with known functions for functional context

  • Standardized stability assays:

    • Employ multiple techniques (CD spectroscopy, DSC, activity retention)

    • Use identical buffer conditions where possible

    • Include appropriate controls at each temperature point

  • Progressive thermal challenge approach:

    • Expose proteins to gradually increasing temperatures

    • Monitor both structural integrity and functional activity

    • Include recovery measurements after thermal challenge

  • Analysis of stabilizing interactions:

    • Compare amino acid composition, especially charged residues

    • Assess ion pair networks through structural modeling

    • Examine hydrophobic core packing differences

Such comparative studies can reveal specific adaptations contributing to the thermostability of AF_1792, potentially informing protein engineering efforts for enhancing stability of industrial enzymes.

How can conflicting experimental data about AF_1792 function be reconciled?

When faced with contradictory results regarding AF_1792 function, researchers should implement a systematic approach to data reconciliation:

  • Technical validation:

    • Verify protein identity through mass spectrometry

    • Confirm protein folding through circular dichroism

    • Assess batch-to-batch variation in activity

  • Condition-dependent behavior analysis:

    • Test activity under varying temperatures, pH, and salt concentrations

    • Examine cofactor requirements systematically

    • Consider allosteric regulators that might explain variable activity

  • Substrate specificity reassessment:

    • Expand substrate range testing

    • Include structurally related compounds

    • Test concentration-dependent effects

  • Multi-laboratory validation:

    • Implement standardized protocols across laboratories

    • Exchange protein samples between research groups

    • Perform blind tests with coded samples

This approach mirrors successful strategies used to resolve conflicting data about other archaeal proteins, ensuring that apparent contradictions lead to deeper understanding rather than confusion .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.