Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1823 (AF_1823)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AF_1823; Uncharacterized protein AF_1823
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1823
Target Protein Sequence
MNIDTLIIAVAGLFAVASSIGVLLTKDNFYAALYMSVTMLFVAAIYAAFNIQPVVVIIAL IFVGAVGIVTVAIAATYRAGVSRKVNIFWVVPVIVVFAILALAYASMAVESIEVVNPEVF SAVATDYFFVVAFLFTLVVLMMLSAIKLARRVDL
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1823

STRING: 224325.AF1823

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining AF_1823 protein stability?

For optimal stability of recombinant AF_1823 protein, store the lyophilized powder at -20°C/-80°C upon receipt. When preparing working solutions, reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, then add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation). Aliquot this solution to avoid repeated freeze-thaw cycles, which significantly reduce protein stability. Short-term working aliquots may be stored at 4°C for up to one week, while long-term storage requires -20°C/-80°C conditions. The storage buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) is designed to maintain protein integrity during freeze-thaw transitions .

How is recombinant AF_1823 typically expressed and purified?

Recombinant AF_1823 is typically expressed in Escherichia coli expression systems using a construct that incorporates the full-length protein (amino acids 1-154) fused to an N-terminal His-tag. Following expression, the protein undergoes a multi-step purification process:

  • Initial capture using immobilized metal affinity chromatography (IMAC) that exploits the His-tag affinity for metal ions

  • Additional purification steps such as size exclusion chromatography to ensure high purity

  • Quality control using SDS-PAGE to verify purity (>90% is considered acceptable)

  • Final preparation as a lyophilized powder to enhance stability

This approach yields functional protein suitable for structural and biochemical characterization studies. The expression in E. coli rather than native host reflects the technical challenges of archaeal expression systems, though researchers should be aware of potential differences in post-translational modifications .

What controls should be included when designing functional assays for AF_1823?

When designing functional assays for an uncharacterized protein like AF_1823, a comprehensive control strategy is essential:

Control TypeDescriptionPurpose
Negative ControlsBuffer-only conditionsEstablish baseline measurements
Heat-denatured AF_1823Confirm activity requires native protein structure
Positive ControlsWell-characterized proteins from A. fulgidusValidate experimental conditions
Predicted functional homologsBenchmark expected activity levels
Experimental ControlsVarious temperature points (25-80°C)Determine optimal temperature for activity
pH range (5.0-9.0)Identify pH dependence
Cofactor exclusion/additionIdentify essential cofactors

Additionally, include time-course measurements to capture reaction kinetics and establish linearity ranges. When designing experiments, carefully distinguish between explanatory variables (protein concentration, temperature, pH) and response variables (activity measurements), while controlling for potential lurking variables that might influence results .

How should temperature considerations be incorporated into experimental design when working with AF_1823?

Temperature considerations are particularly critical when working with proteins from hyperthermophilic organisms like Archaeoglobus fulgidus. Experimental designs should incorporate the following temperature-related factors:

  • Perform activity assays across a temperature gradient (40-80°C), with particular focus on the 60-70°C range that corresponds to the optimal growth temperature of A. fulgidus .

  • Include temperature stability experiments by pre-incubating the protein at various temperatures for different time periods before activity measurement.

  • Design buffers specifically for high-temperature work, avoiding components that degrade rapidly at elevated temperatures (e.g., replace Tris with HEPES or phosphate buffers).

  • Consider the effect of temperature on substrate stability, interaction kinetics, and equilibrium constants, which may differ significantly from mesophilic conditions.

  • Implement appropriate controls at each temperature point, including well-characterized thermostable proteins from A. fulgidus as positive controls.

These considerations will help ensure that experimental conditions reflect the native environment of AF_1823, which is essential for obtaining physiologically relevant results .

What statistical approaches are most appropriate for analyzing characterization data for an uncharacterized protein?

For rigorous analysis of characterization data for AF_1823, implement a multi-tiered statistical approach:

This comprehensive statistical framework allows for rigorous hypothesis testing while accounting for the experimental complexity inherent in characterizing proteins with unknown functions .

How can computational approaches be used to predict potential functions of AF_1823?

A hierarchical computational strategy can help predict potential functions of uncharacterized proteins like AF_1823:

  • Sequence-based analysis:

    • PSI-BLAST searches against characterized protein databases

    • Identification of conserved motifs using MEME or similar tools

    • Transmembrane topology prediction using TMHMM, given the hydrophobic sequence profile

  • Structural prediction:

    • Generation of 3D models using AlphaFold2 or RoseTTAFold

    • Structural comparison against known protein structures using DALI

    • Binding site prediction using computational tools like SiteMap or FTMap

  • Systems-based approaches:

    • Genomic context analysis (examining neighboring genes in A. fulgidus)

    • Co-expression network analysis using available transcriptomic data

    • Integration with archaeal clusters of orthologous genes (arCOG) functional categories

  • Molecular dynamics simulations:

    • Simulations at elevated temperatures (60-70°C) to model native conditions

    • Assessment of membrane integration using coarse-grained models

    • Identification of potential ligand interaction sites

This multi-layered approach can generate testable hypotheses about AF_1823's function, guiding experimental design and prioritizing potential functional assays.

What techniques are most effective for determining membrane topology of AF_1823?

Determining the membrane topology of AF_1823 requires a combination of computational prediction and experimental validation techniques:

ApproachTechniqueInformation Provided
ComputationalTMHMM, TOPCONS, MEMSATPrediction of transmembrane helices
SignalPSignal peptide prediction
LIPS (LIPid-facing Surface)Membrane-facing residues
BiochemicalPEGylation accessibilityExposed cysteine residues
Protease protection assaysAccessible protein regions
Chemical labeling (SCAM)Side chain accessibility
BiophysicalEPR spectroscopy with spin labelsDistance measurements
FRET with strategically placed fluorophoresDynamic structural information
StructuralCryo-electron microscopyDirect visualization in membrane
X-ray crystallographyHigh-resolution structure

The experimental approach should begin with creating cysteine mutants at predicted loop regions, followed by accessibility studies using membrane-impermeable reagents. These experiments should be performed in a reconstituted membrane system that mimics the archaeal membrane environment . Results from multiple techniques should be integrated to generate a comprehensive topology model, which is essential for understanding how AF_1823 might interact with its environment.

How might AF_1823 be involved in Archaeoglobus fulgidus adaptation to extreme environments?

The potential role of AF_1823 in A. fulgidus adaptation to extreme environments can be investigated through several complementary approaches:

  • Comparative genomics: Analyze the conservation and evolution of AF_1823 across Archaeoglobus species and related archaea living in different extreme environments.

  • Transcriptomic analysis: Examine expression changes of AF_1823 under various stress conditions (temperature shifts, pH changes, oxidative stress) using RNA sequencing or qPCR .

  • Proteomics studies: Investigate post-translational modifications and protein-protein interactions under different stress conditions.

  • Phenotypic characterization: Create AF_1823 knockout or knockdown strains and assess their growth and survival under extreme conditions compared to wild-type.

  • Structural stability analysis: Compare the thermal stability of AF_1823 with homologous proteins from mesophilic organisms to identify adaptations that enhance stability at high temperatures.

The high hydrophobicity of AF_1823 and its predicted membrane localization suggest it may contribute to membrane stability under extreme conditions, potentially through roles in membrane permeability, ion homeostasis, or stress sensing . Its investigation may reveal novel archaeal adaptations to extreme environments.

How does AF_1823 compare to the well-characterized RadA protein from Archaeoglobus fulgidus?

Comparing AF_1823 with the well-characterized RadA protein from A. fulgidus reveals fundamental differences in structure and function:

FeatureAF_1823RadA
Amino Acid Length154 amino acids ~350 amino acids
Predicted StructureMembrane protein with multiple transmembrane domains Forms ring structures in solution
HydrophobicityHighly hydrophobic sequence Moderate hydrophobicity with hydrophilic domains
DNA BindingNot predictedBinds single-stranded DNA
ATPase ActivityUnknownSingle-stranded DNA-dependent ATPase
Temperature OptimumLikely 60-70°C (based on A. fulgidus)60-70°C
Cellular FunctionUncharacterized, likely membrane-associatedDNA repair and homologous recombination

While both proteins come from the same hyperthermophilic organism and share adaptation to high temperatures, their structural and functional characteristics appear distinct. RadA functions in DNA metabolism as evidenced by its DNA binding, ATPase activity, and formation of nucleoprotein filaments , whereas AF_1823's hydrophobic profile and predicted transmembrane regions suggest membrane-associated functions possibly related to transport or signaling .

What insights might be gained from studying AF_1823 in the context of carbon monoxide metabolism in A. fulgidus?

Investigating AF_1823 in the context of carbon monoxide metabolism could provide valuable insights, considering A. fulgidus' ability to utilize CO as an energy source :

  • Expression correlation analysis: Determine if AF_1823 is co-expressed with known CO metabolism genes under CO-rich growth conditions through transcriptomic analysis.

  • Protein localization: Investigate whether AF_1823 is spatially associated with CO oxidation enzyme complexes within the cell.

  • Membrane function analysis: Test if AF_1823 is involved in CO transport across the membrane or in sensing extracellular CO levels, given its predicted membrane localization .

  • Functional complementation: Perform knockout studies of AF_1823 to assess its impact on CO utilization and metabolism.

  • Protein interaction studies: Determine if AF_1823 physically interacts with components of the CO metabolism pathway, particularly membrane-bound complexes involved in electron transport.

This investigation would contribute to understanding how A. fulgidus has adapted to utilize CO as an energy source and potentially reveal novel components of archaeal CO metabolism pathways .

What evolutionary insights can be gained from comparative analysis of AF_1823 across archaeal species?

Evolutionary analysis of AF_1823 across archaeal species can yield significant insights into archaeal adaptation and protein function:

  • Phylogenetic distribution: Map the presence/absence of AF_1823 homologs across the archaeal domain to determine its evolutionary history and correlation with specific ecological niches.

  • Sequence conservation analysis: Identify highly conserved residues, which likely indicate functional or structural importance, using multiple sequence alignments of AF_1823 homologs.

  • Selection pressure analysis: Calculate dN/dS ratios across aligned sequences to identify regions under purifying selection (functionally constrained) versus those under positive selection (potentially indicating adaptive evolution).

  • Domain architecture comparison: Examine whether AF_1823 homologs maintain similar domain organization across diverse archaeal lineages or show evidence of domain shuffling.

  • Horizontal gene transfer assessment: Investigate if AF_1823 shows evidence of horizontal gene transfer between archaeal lineages or even across domains of life.

This evolutionary perspective could reveal whether AF_1823 represents an ancient protein present in the archaeal ancestor or a more recent adaptation specific to certain archaeal lineages with particular metabolic requirements or environmental adaptations .

What reconstitution methods are most appropriate for functional studies of AF_1823?

Given the predicted membrane localization of AF_1823, appropriate reconstitution methods are crucial for functional characterization:

Reconstitution MethodAdvantagesConsiderations
Liposome Incorporation- Mimics native membrane environment
- Allows control of lipid composition
- Enables transport studies
- Use archaeal-like lipids (tetraether lipids)
- Perform at high temperatures (60-70°C)
Nanodiscs- Defined size and composition
- Accessible from both sides
- Compatible with many biophysical techniques
- Stability at high temperatures may be challenging
- May require thermostable scaffold proteins
Detergent Micelles- Simpler preparation
- Compatible with many assays
- Good for initial characterization
- Less physiologically relevant
- Select detergents stable at high temperatures
Amphipols- Maintains protein stability
- Less disruptive than detergents
- Compatible with structural studies
- May restrict conformational changes
- Limited experience with archaeal proteins

The reconstitution process should begin with protein solubilization using mild detergents, followed by incorporation into the selected membrane mimetic system. For thermophilic proteins like AF_1823, reconstitution procedures should be optimized for stability at elevated temperatures. Functional assays should then test potential activities such as ion transport, substrate binding, or response to environmental changes .

What spectroscopic approaches are most valuable for characterizing the structural properties of AF_1823?

A multi-technique spectroscopic approach provides comprehensive structural characterization of AF_1823:

These complementary techniques provide a comprehensive structural characterization, from secondary structure elements to tertiary contacts, and should be performed under conditions mimicking the native environment of A. fulgidus .

What expression systems might yield functional AF_1823 for in-depth biochemical studies?

Selecting the appropriate expression system is crucial for obtaining functional AF_1823:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli- Well-established protocols
- High yields
- Cost-effective
- Different membrane composition
- Potential folding issues
- Use specialized strains (C41/C43)
- Optimize codon usage
- Lower induction temperature
Yeast (P. pastoris)- Eukaryotic machinery
- Good for membrane proteins
- Secretion capability
- Glycosylation differs from archaea
- Longer expression time
- Use minimal glycosylation strains
- Optimize growth medium
- Temperature control
Cell-free systems- Rapid protein production
- Direct incorporation into liposomes
- Avoids toxicity issues
- Lower yields
- Higher cost
- Technical complexity
- Use archaeal-derived components
- Add archaeal chaperones
- Supplement with archaeal lipids
Archaeal hosts- Native cellular machinery
- Authentic post-translational modifications
- Proper folding environment
- Limited genetic tools
- Challenging growth conditions
- Lower yields
- Use closely related mesophilic archaea
- Develop inducible promoters
- Optimize culture conditions

While E. coli systems have been successfully used for recombinant AF_1823 production , archaeal expression hosts might provide more authentically folded protein for specialized studies. For any system, expression at reduced temperatures followed by functional assays at elevated temperatures (60-70°C) may balance between protein production efficiency and native functional characteristics .

How can protein-protein interaction studies be designed to identify AF_1823 binding partners in A. fulgidus?

Designing protein-protein interaction studies for AF_1823 requires specialized approaches suitable for membrane proteins from extremophiles:

  • Crosslinking mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers to capture in vivo interactions

    • Perform experiments at near-native temperatures (50-60°C)

    • Analyze crosslinked peptides using high-resolution mass spectrometry

    • Validate interactions with targeted crosslinking experiments

  • Co-immunoprecipitation with thermostable antibodies:

    • Generate antibodies against AF_1823 or use anti-His antibodies for recombinant protein

    • Perform cell lysis and immunoprecipitation under conditions that preserve membrane protein interactions

    • Identify co-precipitated proteins by mass spectrometry

    • Confirm interactions with reciprocal pulldowns

  • Split-protein complementation assays adapted for thermophiles:

    • Engineer thermostable reporter protein fragments (modified GFP variants)

    • Create fusion constructs with AF_1823 and candidate interactors

    • Express in thermophilic hosts or assay at elevated temperatures

    • Monitor reporter reconstitution as indication of protein interaction

  • Membrane yeast two-hybrid (MYTH) system:

    • Adapt conventional MYTH for high-temperature compatibility

    • Screen against A. fulgidus genomic library or candidate proteins

    • Verify interactions using orthogonal methods

These approaches, when combined, can overcome the challenges of studying membrane protein interactions in extremophilic archaea and provide insights into the functional network of AF_1823 .

What approaches can determine if AF_1823 plays a role in membrane adaptation to extreme environments?

To investigate AF_1823's potential role in membrane adaptation to extreme conditions, implement the following multifaceted approach:

  • Gene knockout/knockdown studies:

    • Generate AF_1823 deletion or conditional expression strains

    • Assess membrane integrity and cellular viability across temperature ranges (50-85°C)

    • Measure membrane fluidity using fluorescence anisotropy at different temperatures

  • Lipidomic analysis:

    • Compare membrane lipid composition between wild-type and AF_1823 mutant strains

    • Analyze changes in membrane lipid profiles under different stress conditions

    • Investigate potential AF_1823-lipid interactions using lipid overlay assays

  • Membrane permeability studies:

    • Measure ion leakage across membranes in wild-type versus mutant cells

    • Reconstitute AF_1823 in liposomes and assess permeability to various solutes

    • Test temperature-dependent changes in membrane permeability

  • Stress response correlation:

    • Monitor AF_1823 expression levels under various stress conditions (temperature shifts, pH changes, osmotic stress)

    • Determine if AF_1823 co-localizes with stress response proteins using fluorescence microscopy

    • Test if overexpression of AF_1823 enhances stress resistance

This comprehensive approach will help determine whether AF_1823 contributes to A. fulgidus' remarkable adaptation to extreme environments through membrane-associated functions .

How can researchers design experiments to elucidate the relationship between AF_1823 structure and thermostability?

To investigate the structure-thermostability relationship of AF_1823, researchers should implement a systematic experimental design:

  • Site-directed mutagenesis studies:

    • Target residues predicted to contribute to thermostability (e.g., charged residues in transmembrane regions)

    • Create a panel of variants with substitutions of hydrophobic residues

    • Assess thermal stability of each variant using thermal shift assays

  • Chimeric protein analysis:

    • Create chimeric proteins by swapping domains between AF_1823 and mesophilic homologs

    • Measure thermal stability of chimeric constructs

    • Identify regions that contribute most significantly to thermostability

  • Structural characterization at different temperatures:

    • Perform CD spectroscopy at temperature intervals (25-90°C)

    • Monitor changes in secondary structure as a function of temperature

    • Compare melting temperatures and unfolding cooperativity between wild-type and variants

  • Molecular dynamics simulations:

    • Conduct simulations at different temperatures (25°C, 50°C, 70°C, 90°C)

    • Analyze protein flexibility, hydrogen bonding networks, and salt bridge formation

    • Identify temperature-dependent conformational changes

  • Hydrogen-deuterium exchange mass spectrometry:

    • Measure exchange rates at different temperatures

    • Identify regions with enhanced protection at elevated temperatures

    • Compare exchange patterns between wild-type and engineered variants

This experimental approach will provide mechanistic insights into how AF_1823 maintains structural integrity at the extreme temperatures of A. fulgidus' native environment (60-70°C) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.