Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1949 (AF_1949)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
AF_1949; Uncharacterized protein AF_1949
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1949
Target Protein Sequence
MLRMRALWLALVLLILSIPAVSAQITVTRDLPDSAKVGDEITVTLALTIGSEKPAGAIIE ESIPDGASYISSSPEATVSEGKLKWAFYGEQLKDMTLQYTVKVEKAGKLEFSGTVKTLLG NENIGGDSELEVSEKSAEQPKGTPGFEAFVAVAVIGSIALLRRKH
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1949

STRING: 224325.AF1949

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and characteristics of Archaeoglobus fulgidus Uncharacterized protein AF_1949?

Archaeoglobus fulgidus Uncharacterized protein AF_1949 (UniProt: O28330) is a 165-amino acid protein from the hyperthermophilic archaeon Archaeoglobus fulgidus strain ATCC 49558/VC-16/DSM 4304 . According to available sequence information, the protein contains a predicted transmembrane domain, suggesting it may be membrane-associated . The amino acid sequence (mLRMRALWLALVLLILSIPAVSAQITVTRDLPDSAKVGDEITVTLALTIGSEKPAGAIIEESIPDGASYISSSPEATVSEGKLKWAFYGEQLKDMTLQYTVKVEKAGKLEFSGTVKTLLGNENIGGDSELEVSEKSAEQPKGTPGFEAFVAVAVIGSIALLRRKH) suggests the presence of hydrophobic regions consistent with membrane integration .

For initial structural characterization, researchers should employ a combination of bioinformatic prediction tools and experimental approaches. Begin with sequence-based structure prediction using programs like PSIPRED, JPred, or AlphaFold to generate hypotheses about secondary structure elements. Follow this with circular dichroism (CD) spectroscopy to experimentally determine secondary structure content (α-helices, β-sheets, random coils) under various conditions, particularly at high temperatures that mimic the native hyperthermophilic environment of A. fulgidus.

What expression systems are most effective for producing recombinant AF_1949 protein?

For archaeal proteins like AF_1949, the selection of an appropriate expression system is critical for obtaining properly folded, functional protein. Based on successful approaches with other archaeal proteins, E. coli remains the most commonly used heterologous expression system due to its simplicity, cost-effectiveness, and high yield potential . Currently available recombinant AF_1949 protein is produced in E. coli with a His-tag for purification purposes .

To optimize expression, consider the following methodological approach:

  • Vector selection: Use T7 promoter-based expression vectors (pET series) with temperature-inducible or IPTG-inducible promoters.

  • E. coli strain selection: BL21(DE3), Rosetta, or Arctic Express strains are recommended; the latter may be particularly useful as it's designed for the expression of proteins from organisms with different codon usage patterns.

  • Expression conditions: Initial induction at lower temperatures (15-25°C) may improve protein folding.

  • Solubility enhancement: Co-expression with archaeal chaperones or fusion to solubility-enhancing tags (MBP, SUMO) may improve yields of soluble protein.

For proteins that prove difficult to express in E. coli, consider alternative systems such as yeasts (Pichia pastoris) or cell-free expression systems. The success of archaeal protein expression can be assessed by western blotting (using anti-His antibodies if a His-tag is present) and SDS-PAGE analysis .

How should researchers design control experiments when studying AF_1949 protein function?

Designing appropriate controls is essential for rigorous experimental design when studying an uncharacterized protein like AF_1949. Following the fundamental principles of experimental design—randomization, replication, and blocking—is critical for generating reliable data .

For functional studies of AF_1949, implement the following control strategy:

  • Negative controls:

    • Expression vector without the AF_1949 insert processed identically to the experimental samples

    • A known unrelated archaeal protein expressed and purified using the same methods

    • For in vivo studies, an AF_1949 knockout strain compared with wild-type A. fulgidus

  • Positive controls:

    • A well-characterized archaeal membrane protein with known function

    • For binding studies, a protein known to interact with archaeal membrane components

  • Technical controls:

    • Multiple biological replicates (minimum three) for each experimental condition

    • Multiple technical replicates within each biological replicate

    • Randomization of sample processing order to minimize batch effects

When analyzing results, statistical methods appropriate for the experimental design should be employed. For example, when comparing multiple treatment groups, ANOVA followed by appropriate post-hoc tests should be used rather than multiple t-tests to control for family-wise error rate .

What approaches can be used to determine the membrane topology of AF_1949?

Determining the membrane topology of AF_1949 is crucial for understanding its functional role. Based on its amino acid sequence containing a predicted transmembrane domain, a multi-technique approach is recommended:

  • Computational prediction: Begin with transmembrane prediction algorithms like TMHMM, Phobius, and TOPCONS to generate initial topology models. Compare outputs from multiple algorithms to identify consensus predictions.

  • Experimental validation using reporter fusion approaches:

    • PhoA (alkaline phosphatase) fusion strategy: Create fusion constructs of AF_1949 fragments with PhoA, which is active only when located in the periplasm.

    • GFP fusion strategy: GFP fluoresces when located in the cytoplasm but not in the periplasm.

    • Create a series of truncation constructs fused to these reporters at different positions to map the orientation of transmembrane segments.

  • Protease protection assays:

    • Express and reconstitute AF_1949 in proteoliposomes

    • Treat with proteases (trypsin, chymotrypsin)

    • Analyze protected fragments by mass spectrometry

    • Regions protected from protease digestion are likely membrane-embedded

  • Cysteine accessibility methods:

    • Introduce cysteine residues at strategic positions throughout the protein

    • Assess accessibility to membrane-impermeable thiol-reactive reagents

    • Accessible cysteines are located on exposed surfaces, while inaccessible ones are embedded in the membrane

Combine data from all approaches to construct a refined topology model, which should be iteratively tested with additional experimental validation.

How can researchers investigate potential protein-protein interactions involving AF_1949?

As an uncharacterized protein, identifying interaction partners of AF_1949 may provide crucial insights into its function. A systematic approach should include:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express His-tagged AF_1949 in A. fulgidus or a related archaeal host if possible

    • Perform crosslinking in vivo to capture transient interactions

    • Purify AF_1949 complexes using immobilized metal affinity chromatography

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions with reciprocal pulldowns

  • Yeast two-hybrid (Y2H) or bacterial two-hybrid screening:

    • Create a bait construct with AF_1949 (considering membrane topology)

    • Screen against an A. fulgidus genomic library

    • For membrane proteins, consider split-ubiquitin or MYTH (membrane yeast two-hybrid) systems specifically designed for membrane proteins

  • Surface plasmon resonance (SPR) for candidate interactions:

    • Immobilize purified AF_1949 on a sensor chip

    • Flow potential interaction partners over the surface

    • Measure binding kinetics and affinity constants

    • This approach is particularly useful for validating interactions identified through screening approaches

  • Co-localization studies:

    • Generate fluorescently tagged versions of AF_1949 and candidate partners

    • Express in suitable host cells

    • Visualize localization patterns using confocal microscopy

    • Quantify co-localization using appropriate statistical measures

When analyzing results, consider that archaeal proteins often have homologs in eukaryotes due to evolutionary conservation, as seen with archaeal Signal Recognition Particle (SRP) components . Therefore, examining potential interactions with homologous human proteins may provide additional functional insights.

What strategies can address the challenges of crystallizing membrane proteins like AF_1949 for structural studies?

Membrane proteins like AF_1949 present significant challenges for structural determination due to their hydrophobic surfaces and conformational flexibility. A comprehensive strategy includes:

For hyperthermophilic archaeal proteins like AF_1949, crystallization attempts at elevated temperatures (30-40°C) may better mimic native conditions and improve conformational stability. Additionally, inclusion of stabilizing ions found in the native environment of A. fulgidus should be considered during purification and crystallization trials.

How should researchers design experiments to determine the function of uncharacterized proteins like AF_1949?

Determining the function of uncharacterized proteins like AF_1949 requires a systematic, multi-faceted approach that integrates bioinformatic predictions with experimental validation:

  • Comparative genomics and bioinformatics:

    • Perform thorough sequence homology searches against diverse databases

    • Identify conserved domains or motifs using InterPro, PFAM, and other tools

    • Analyze genomic context (neighboring genes) in A. fulgidus genome

    • Compare with syntenic regions in related archaeal species

    • Use co-expression databases to identify functionally related genes

  • Phenotypic analysis through gene disruption:

    • Generate knockout or knockdown strains of AF_1949 in A. fulgidus

    • Perform comprehensive phenotypic characterization under various conditions

    • Measure growth rates, stress responses, and metabolic profiles

    • Use complementation studies to confirm phenotype specificity

  • Biochemical activity screening:

    • Purify recombinant AF_1949 protein under native conditions

    • Test for enzymatic activities based on bioinformatic predictions

    • Screen against substrate libraries if no specific function is predicted

    • Measure binding to potential ligands using thermal shift assays

  • Subcellular localization studies:

    • Generate fluorescently tagged versions or use immunolocalization

    • Determine precise localization within archaeal cells

    • Correlate localization with potential functional compartments

The experimental design should incorporate fundamental principles of randomization, replication, and blocking to ensure statistical validity . For example, when performing growth assays with knockout strains, randomize the plate positions, include multiple biological replicates (minimum three), and block for environmental variables such as incubator position or batch effects .

What statistical considerations are most important when analyzing data from AF_1949 functional studies?

The statistical analysis of functional studies for AF_1949 should be carefully planned during the experimental design phase, not after data collection. Key considerations include:

  • Sample size determination:

    • Conduct power analysis before beginning experiments

    • For typical protein functional studies, aim for a minimum of 3-5 biological replicates

    • Include technical replicates (3+) within each biological replicate

    • Account for expected variability in archaeal protein expression and function

  • Appropriate statistical tests:

    • For comparing multiple experimental conditions, use ANOVA rather than multiple t-tests

    • When comparing growth curves or time-series data, consider repeated measures ANOVA

    • For binding studies, use nonlinear regression for curve fitting to determine KD values

    • Apply appropriate post-hoc tests with correction for multiple comparisons

  • Dealing with experimental variability:

    • Implement blocking designs to account for batch effects

    • Randomize sample processing order to minimize systematic errors

    • Consider using mixed-effects models to account for random and fixed effects

  • Validation of assumptions:

    • Test for normality of data distribution (Shapiro-Wilk test)

    • Check for homogeneity of variance (Levene's test)

    • When assumptions are violated, consider non-parametric alternatives or data transformation

  • Reporting standards:

    • Report exact p-values rather than thresholds (e.g., p = 0.024 rather than p < 0.05)

    • Include measures of effect size alongside significance values

    • Present confidence intervals for key parameters

    • Clearly describe all statistical methods in materials and methods section

How can researchers optimize conditions for activity assays of thermophilic proteins like AF_1949?

Working with proteins from hyperthermophilic archaea like A. fulgidus presents unique challenges for activity assays. The following methodological approach is recommended:

  • Temperature considerations:

    • Conduct assays at elevated temperatures (70-85°C) that reflect the native environment of A. fulgidus

    • Use temperature-controlled spectrophotometers or plate readers

    • For enzymes, determine temperature optima by assaying across a range (40-95°C)

    • Consider temperature-stable assay components and buffers

  • Buffer optimization:

    • Test buffers with high thermal stability (PIPES, HEPES, phosphate)

    • Include stabilizing ions found in the native environment (Mg2+, K+, Na+)

    • Adjust pH to account for temperature effects on buffer pKa

    • Consider adding osmolytes or stabilizers like glycerol, trehalose, or trimethylamine N-oxide

  • Substrate stability:

    • Ensure substrates are stable at high temperatures for the duration of the assay

    • For unstable substrates, consider pulse-chase approaches or rapid sampling

    • Monitor substrate degradation in control reactions without enzyme

  • Equipment and materials:

    • Use PCR tubes or high-temperature-resistant plastics for reactions

    • Seal reaction vessels to prevent evaporation

    • Consider oil overlays for longer incubations

    • Use internal temperature controls to verify actual reaction temperatures

  • Assay validation:

    • Include known thermostable enzymes as positive controls

    • Verify that signal changes are enzyme-dependent and not due to thermal effects

    • Establish linear ranges for both substrate concentration and time

By carefully optimizing these conditions, researchers can obtain reliable activity data for thermophilic proteins like AF_1949, even when the specific activity is not yet known. A systematic approach to optimization, testing one variable at a time while holding others constant, will help identify optimal assay conditions.

How should researchers approach contradictory results when characterizing AF_1949?

When encountering contradictory results in the characterization of an uncharacterized protein like AF_1949, a systematic troubleshooting approach is essential:

  • Evaluate experimental variables:

    • Compare protein preparation methods between contradictory experiments

    • Assess buffer composition, pH, salt concentration, and temperature differences

    • Review protein storage conditions and potential degradation

    • Examine the presence/absence of critical cofactors or metal ions

  • Consider protein conformational states:

    • Test whether different purification approaches yield different conformational populations

    • Use techniques like size exclusion chromatography to separate oligomeric states

    • Perform circular dichroism under varying conditions to detect conformational changes

    • Consider native vs. denatured states in different assays

  • Validate protein identity and integrity:

    • Confirm protein sequence by mass spectrometry

    • Check for post-translational modifications that may vary between preparations

    • Verify tag presence/absence and its potential impact on function

    • Assess protein homogeneity by native PAGE or analytical ultracentrifugation

  • Cross-validate with orthogonal techniques:

    • If contradictory results arise from different methodologies, implement a third approach

    • Use multiple detection methods for the same property

    • Consider in vivo vs. in vitro discrepancies and their biological relevance

  • Statistical reassessment:

    • Increase sample size and number of replicates

    • Review statistical methods for appropriateness to the data structure

    • Consider whether outliers are meaningful or represent technical artifacts

    • Calculate effect sizes to determine practical significance beyond p-values

When reporting contradictory results, transparent documentation of all conditions is essential. Present alternative hypotheses that might explain the contradictions, and design decisive experiments to discriminate between them. Remember that contradictory results often lead to new insights about protein regulation or context-dependent functions.

What approaches can help distinguish genuine protein function from artifacts in AF_1949 studies?

Distinguishing genuine functions from artifacts is particularly challenging for uncharacterized proteins like AF_1949. Implement these methodological approaches:

  • Concentration-dependence testing:

    • Perform activity assays across a wide range of protein concentrations

    • True enzymatic activities typically show linear dependence on enzyme concentration

    • Plot activity vs. protein concentration to identify non-linear relationships that may indicate artifacts

  • Specificity controls:

    • Compare wild-type protein with site-directed mutants of predicted active sites

    • Test closely related proteins or paralogs for similar activities

    • Assess activity with structurally similar but biologically unrelated substrates

  • Physico-chemical validation:

    • Confirm that observed activities occur under conditions compatible with the native environment of A. fulgidus

    • Test pH and temperature profiles for consistency with hyperthermophilic archaeal physiology

    • Verify that kinetic parameters (KM, kcat) are in biologically relevant ranges

  • In vivo correlation:

    • Validate biochemical findings with in vivo phenotypes

    • Use genetic approaches (knockouts, complementation) to confirm specificity

    • Correlate protein expression levels with observed cellular activities

  • Contamination assessment:

    • Prepare protein using multiple expression and purification strategies

    • Analyze samples by mass spectrometry to detect potential contaminants

    • Include mock purifications from expression systems lacking the target gene

A systematic table of evidence can help evaluate the strength of functional assignments:

Evidence TypeStrong EvidenceWeak EvidenceMethods for Improvement
Biochemical specificityActivity with specific substrates, inhibited by specific compoundsPromiscuous activity across multiple unrelated substratesStructure-guided mutagenesis of potential active sites
Concentration dependenceLinear relationship between protein amount and activityActivity doesn't scale with protein concentrationTitration experiments with wider concentration range
Genetic validationClear phenotype in knockout strains, rescued by complementationNo detectable phenotype or non-specific effectsTest under various stress conditions, combine with other mutations
Structural featuresConserved catalytic residues or binding motifsLack of recognizable functional domainsStructural studies (X-ray, cryo-EM) to identify potential functional sites
Evolutionary conservationFunction conserved in homologs from related speciesFunction not conserved or no clear homologs existBroader phylogenetic analysis, ancestral sequence reconstruction

How can computational approaches complement experimental methods in studying AF_1949?

Integrating computational and experimental approaches creates a powerful framework for understanding uncharacterized proteins like AF_1949:

  • Structure prediction and analysis:

    • Leverage AlphaFold2 or RoseTTAFold to generate structural models

    • Identify potential binding pockets or catalytic sites

    • Compare predicted structures with known protein families

    • Use molecular dynamics simulations to explore conformational dynamics

    • Guide experimental design of site-directed mutagenesis

  • Phylogenetic profiling:

    • Analyze the co-occurrence patterns of AF_1949 with other genes across archaeal species

    • Identify genes with similar phylogenetic profiles that may be functionally related

    • Correlate presence/absence with specific metabolic capabilities

    • This approach has proven valuable for archaeal proteins with eukaryotic homologs

  • Network analysis:

    • Integrate data from experimental protein-protein interactions

    • Predict functional associations using tools like STRING

    • Identify functional modules and pathways

    • Map AF_1949 into the broader cellular network of A. fulgidus

  • Machine learning approaches:

    • Train models on known archaeal protein functions to predict AF_1949 function

    • Use feature extraction from sequence and predicted structure

    • Implement ensemble methods that combine multiple predictors

    • Validate predictions experimentally in an iterative process

  • Molecular docking and virtual screening:

    • Screen libraries of potential ligands or substrates in silico

    • Prioritize compounds for experimental validation

    • Estimate binding affinities and interaction modes

    • Guide the design of binding assays

The computational-experimental cycle should be iterative, with experimental results informing refined computational models, and computational predictions guiding new experiments. This bidirectional approach is particularly valuable for challenging targets like archaeal membrane proteins, where direct experimental characterization may be difficult.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.