Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1999 (AF_1999)

Shipped with Ice Packs
In Stock

Description

General Information

AF_1999 refers to an uncharacterized protein originating from Archaeoglobus fulgidus, specifically a recombinant form produced for research purposes. A. fulgidus is a hyperthermophilic archaeon known for its ability to reduce sulfate at high temperatures and pressures, often found in marine and deep-sea environments . The study of its proteins, including AF_1999, can provide insights into the organism's adaptation to extreme conditions and its metabolic processes .

Characteristics of Archaeoglobus fulgidus

Archaeoglobus fulgidus is a well-studied species within its genus, notable for being the first hyperthermophilic sulfate-reducing archaeon to be isolated and characterized, and among the first archaea to have its genome sequenced . It can grow as a chemoorganoheterotroph and a chemolithoautotroph, utilizing various organic and inorganic carbon compounds . A. fulgidus thrives in hot, sulfate-rich, anoxic marine environments, with optimal growth temperatures between 75 and 90°C .

Heat Shock Response Studies

Studies using whole-genome microarrays have explored the heat shock response of A. fulgidus, identifying hundreds of open reading frames (ORFs) that show altered transcript abundance under heat stress . These ORFs span a range of cellular functions, including energy production, amino acid metabolism, and signal transduction, with many being uncharacterized . One such ORF, AF1298, contains a putative helix-turn-helix DNA binding motif and is involved in heat shock regulation .

Role in High-Pressure Environments

A. fulgidus exhibits exponential growth up to 60 MPa under heterotrophic metabolism and can grow autotrophically from 0.3 to 40 MPa at 83°C . This piezotolerant autotrophic growth suggests an important role for A. fulgidus in high-temperature, subsurface environments . Its ability to perform heterotrophic sulfate reduction at elevated pressures indicates its significance in subsurface hydrothermal environments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
AF_1999; Uncharacterized protein AF_1999
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1999
Target Protein Sequence
MRDMIWTYRALNNPAARRKWTAFILLIVLAGFGYTAYKIAGGAEVGKSLIAAAIFALFIS LYAIITLGKPRHYYIEGDYVYYRPFKTNLKDIEGFEVDEERRVIRLKGAGIFSVRTLYFD NEDDLRQAVRRLERIVKR
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1999

STRING: 224325.AF1999

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus protein AF_1999?

AF_1999 is an uncharacterized protein from the hyperthermophilic, sulphate-reducing archaeon Archaeoglobus fulgidus. It is a 138-amino acid protein encoded by the AF_1999 gene in the A. fulgidus genome . Computational structure modeling through AlphaFold shows a high model confidence score (pLDDT global: 93.21), suggesting a well-defined three-dimensional structure . Recent research indicates AF_1999 may be structurally related to the Archaeoglobus fulgidus Argonaute (AfAgo) system involved in nucleic acid processing, potentially forming part of a heterodimeric complex .

A. fulgidus has emerged as an important model organism for studying thermostable enzymes due to its ability to thrive at high temperatures (optimal growth around 80°C) . Its proteins, including AF_1999, are valuable for both fundamental archaeal biology research and potential biotechnological applications requiring thermostable proteins.

What is known about the structure of AF_1999?

The structure of AF_1999 has been computationally modeled using AlphaFold (model ID: AF-O28280-F1), resulting in a high-confidence structural prediction with a global pLDDT score of 93.21 . This exceptionally high confidence score suggests the predicted structure is likely accurate, though experimental validation through X-ray crystallography or NMR spectroscopy would be needed for confirmation.

Model Confidence Breakdown:

  • Very high (pLDDT > 90): Most of the protein structure

  • Confident (70 < pLDDT ≤ 90): Some regions

  • Low (50 < pLDDT ≤ 70): Minimal regions

  • Very low (pLDDT ≤ 50): Few if any regions

The AlphaFold model was released in December 2021 and updated in September 2022 . While computational modeling provides valuable insights, no experimental structures have been reported in the literature available from our search results. Therefore, the functional implications of this predicted structure remain to be experimentally validated.

What expression systems are suitable for recombinant AF_1999 production?

While specific expression systems for AF_1999 are not directly addressed in the search results, we can apply principles for expressing thermophilic archaeal proteins:

Table 1: Recommended Expression Systems for Recombinant AF_1999

Expression SystemAdvantagesConsiderationsRecommended Conditions
E. coli BL21(DE3)Widely available, simple to useCodon optimization may be requiredIPTG induction at 0.1-0.5 mM, 18-30°C
E. coli RosettaBetter for rare codons in archaeal genesHigher cost than standard strainsLower induction temperature (16-25°C)
Thermococcus kodakarensisArchaeal host, better foldingMore complex methodologyGrowth at 60-80°C
Cell-free systemsAvoids toxicity issuesLower yield, higher costTemperature optimization critical

Methodological approach:

  • Clone AF_1999 gene into multiple expression vectors with various tags (His6, GST, MBP)

  • Transform into different host strains

  • Test expression at various temperatures (16°C, 30°C, 37°C)

  • Analyze solubility and yield under different induction conditions

  • Select optimal system based on protein quality and quantity

How can I purify recombinant AF_1999?

Recommended Purification Strategy:

  • Initial Extraction: Since the protein sequence suggests potential membrane association, use detergent-based lysis buffers (e.g., 0.5-1% Triton X-100 or n-dodecyl β-D-maltoside).

  • Heat Treatment: Exploit the thermostability of A. fulgidus proteins by including a heat step (70°C for 20 minutes) to denature and precipitate less thermostable contaminating proteins .

  • Affinity Chromatography: If expressing with an affinity tag, use corresponding resin. For His-tagged protein, use IMAC with nickel or cobalt resin with imidazole gradients for elution.

  • Ion Exchange Chromatography: Based on the predicted isoelectric point.

  • Size Exclusion Chromatography: Final polishing step to remove aggregates and ensure homogeneity.

Buffer Optimization Table:

Buffer ComponentRecommended RangeRationale
NaCl300-500 mMMimics halophilic environment of A. fulgidus
Buffer (HEPES or Tris)pH 7.5-8.5Based on predicted pI
Glycerol10-20%Enhances stability of thermophilic proteins
Reducing agent (DTT or TCEP)1-5 mMPrevents oxidation of cysteine residues
Divalent cations (Mg²⁺)5-10 mMMay enhance structural stability

A systematic approach testing various purification strategies is necessary to determine the optimal protocol for AF_1999.

What is the functional relationship between AF_1999 and the Archaeoglobus fulgidus Argonaute (AfAgo)?

Recent research has revealed a significant functional relationship between AF_1999 and the Archaeoglobus fulgidus Argonaute (AfAgo). According to structural and biochemical studies, AfAgo forms a heterodimeric complex with a protein encoded upstream in the same operon, which functions as a structural equivalent of the N-L1-L2 domains of long prokaryotic Argonautes (pAgos) .

While the search results don't explicitly name AF_1999 as this upstream protein, the description strongly suggests that AF_1999 may be this partner. This heterodimeric complex is "structurally equivalent to a long PAZ-less pAgo" and "outperforms standalone AfAgo in guide RNA-mediated target DNA binding" .

Methodological Approaches to Confirm This Relationship:

  • Co-immunoprecipitation with anti-AfAgo antibodies followed by mass spectrometry

  • Reciprocal yeast two-hybrid or bacterial two-hybrid assays

  • Surface plasmon resonance to measure binding kinetics and affinity

  • SAXS and cryo-EM structural analysis of the complex, as described in the research

  • Functional nucleic acid binding and processing assays comparing standalone AfAgo with the heterodimeric complex

How does the structure of AF_1999 contribute to its role in protein complexes?

Based on recent studies of AfAgo and its interaction partner , we can infer how AF_1999's structure might contribute to its function in protein complexes:

Structural Contributions:

  • Domain Complementation: If AF_1999 indeed functions as the upstream partner of AfAgo, it provides structural domains (N-L1-L2) that complement the MID and PIWI domains of AfAgo to form a more complete Argonaute-like architecture .

  • Complex Stability: The heterodimeric complex formed between AfAgo and its partner demonstrated superior performance in guide RNA-mediated target DNA binding compared to standalone AfAgo , suggesting that AF_1999's structure stabilizes the nucleic acid binding interface.

  • Evolutionary Adaptation: As described in the research, AfAgo is "phylogenetically classified as a long-B pAgo" but contains "only MID and catalytically inactive PIWI domains in a single polypeptide chain" . The partnership with AF_1999 may represent an evolutionary solution to maintain functional capabilities while splitting the protein into two separate components.

Experimental Methods to Investigate Structural Contributions:

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Site-directed mutagenesis of predicted interface residues followed by binding assays

  • FRET-based assays to detect conformational changes upon complex formation

  • Crystallographic or cryo-EM studies of the AF_1999-AfAgo complex with and without nucleic acids

What experimental approaches can characterize the function of AF_1999?

A comprehensive experimental strategy to characterize AF_1999 would include:

Table 2: Multi-level Experimental Approach for AF_1999 Characterization

LevelTechniquesExpected Outcomes
Biochemical Characterization- Pull-down assays with AfAgo
- Surface plasmon resonance
- EMSA and filter binding assays
- Isothermal titration calorimetry
- Confirmation of protein interactions
- Binding kinetics and thermodynamics
- Nucleic acid binding specificity
Structural Analysis- X-ray crystallography
- Cryo-EM of complexes
- SAXS for solution structure
- HDX-MS for dynamics
- High-resolution structure
- Interaction interfaces
- Conformational changes
- Dynamic regions
Functional Studies- In vitro reconstitution of complexes
- Nuclease/helicase activity assays
- Mutational analysis
- Temperature-dependent activity profiles
- Biochemical function
- Catalytic residues
- Structure-function relationships
- Thermostability parameters
Cellular Studies- Gene deletion in native host
- Localization studies
- Protein-protein interaction networks
- Transcriptomics after perturbation
- Biological role
- Cellular context
- Pathway integration
- Physiological impact

This multi-faceted approach aligns with methods used in recent studies of the AfAgo complex, which employed "SAXS, X-ray crystallography, cryo-EM, and various biochemical and biophysical techniques" to elucidate its function and structure.

How does temperature affect the stability and function of recombinant AF_1999?

As a protein from the hyperthermophilic archaeon Archaeoglobus fulgidus, which grows optimally around 80°C , AF_1999 likely exhibits distinctive temperature-dependent properties:

Temperature Effects on Stability:

  • Exceptional Thermostability: AF_1999 likely maintains structural integrity at temperatures between 60-90°C, similar to other A. fulgidus proteins. For comparison, the A. fulgidus RadA protein functions optimally at 60-70°C .

  • Heat Purification Potential: The thermal stability may allow for heat treatment during purification (70-80°C for 15-30 minutes) to selectively denature contaminating proteins while retaining AF_1999 in its native state.

  • Cold Sensitivity: Some hyperthermophilic proteins exhibit decreased stability or altered conformation at lower temperatures, which may impact storage and experimental conditions for AF_1999.

Temperature Effects on Function:
If AF_1999 forms part of the AfAgo complex involved in nucleic acid processing, temperature would likely affect:

  • Binding affinity for protein partners and nucleic acids

  • Rates of complex formation and dissociation

  • Conformational dynamics relevant to function

Methodological Approaches to Characterize Temperature Effects:

  • Thermal Stability Analysis:

    • Differential scanning calorimetry (DSC) to determine melting temperature (Tm)

    • Circular dichroism (CD) spectroscopy at varying temperatures (20-95°C)

    • Thermofluor assays to screen stabilizing buffer conditions

  • Temperature-Dependent Activity:

    • Nucleic acid binding assays across a temperature range (30-90°C)

    • Complex formation kinetics at different temperatures

    • Activity measurements of reconstituted complexes

Understanding these temperature-dependent properties is crucial for both experimental design and potential biotechnological applications of AF_1999.

What evolutionary insights can be gained from studying AF_1999 homologs?

Comparative analysis of AF_1999 homologs across archaeal species can provide valuable evolutionary insights:

Phylogenetic Analysis Approach:

  • Sequence Homology: BLAST searches against archaeal genomes in the NCBI Reference Sequence database, following methods similar to those used for AfAgo homolog identification .

  • Multiple Sequence Alignment: Using accuracy-oriented alignment tools like MAFFT (L-INS-i mode) to identify conserved residues and motifs .

  • Clustering: Reducing sequence redundancy by clustering homologs with ≥90% sequence identity and ≥90% alignment coverage using MMseqs2 .

  • Tree Construction: Building maximum likelihood phylogenetic trees to visualize evolutionary relationships.

Key Evolutionary Questions to Address:

  • Co-evolution with AfAgo: Does AF_1999 show evolutionary patterns mirroring those of AfAgo across archaeal species? Co-evolution would strengthen the hypothesis of functional interdependence.

  • Domain Conservation: Which regions of AF_1999 show the highest conservation, suggesting functional importance?

  • Genomic Context: Is the operonic arrangement with AfAgo conserved across species, or are there lineage-specific differences?

  • Selection Pressure: Which residues show signatures of purifying or positive selection?

Table 3: Expected Evolutionary Patterns and Their Implications

Evolutionary PatternObservation MethodFunctional Implication
Conserved interface residuesMultiple sequence alignmentCritical for complex formation
Co-evolution with AfAgoMirror-tree analysisFunctional interdependence
Conserved operonic structureSynteny analysisRegulatory co-expression
Variable N-terminal regionConservation scoringPossible species-specific adaptations
Signatures of positive selectiondN/dS ratio analysisAdaptation to different environments

These evolutionary analyses could help reconstruct the history of the AfAgo system across archaea and provide insights into the functional specialization of AF_1999.

What are the challenges in crystallizing AF_1999 for structural studies?

Obtaining high-quality crystals of AF_1999 for X-ray diffraction studies presents several challenges:

Specific Challenges for AF_1999:

  • Membrane Association: The sequence analysis suggests hydrophobic regions that may indicate membrane association, which complicates crystallization due to stability issues in aqueous solutions.

  • Protein Interactions: If AF_1999 naturally functions in a complex with AfAgo , it might adopt different conformations when isolated versus in the complex, potentially complicating crystallization of the free protein.

  • Thermostability Considerations: As a protein from a hyperthermophilic organism growing optimally at ~80°C , crystallization conditions might need to balance the protein's native environment with practical crystallization temperatures.

Methodological Approaches to Overcome Challenges:

  • Construct Optimization:

    • Design multiple truncation constructs based on predicted domain boundaries

    • Surface entropy reduction (SER) to replace surface residues with alanines

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

  • Crystallization Strategy:

    • Sparse matrix screening at different temperatures (4°C, 18°C, 37°C)

    • Lipidic cubic phase for potential membrane-associated regions

    • Co-crystallization with binding partners (AfAgo) or ligands

    • Use of antibody fragments to stabilize flexible regions

  • Alternative Approaches:

    • Cryo-EM for the AF_1999-AfAgo complex

    • NMR for structural characterization of smaller domains

    • SAXS for low-resolution envelope of the full protein

Researchers studying the AfAgo complex successfully employed both X-ray crystallography and cryo-EM , suggesting these methods could also be effective for AF_1999 structural studies.

How can computational approaches complement experimental studies of AF_1999?

Computational methods provide powerful tools to guide and enhance experimental studies of AF_1999:

Structural Prediction and Analysis:

  • Advanced Modeling: AlphaFold has already provided a high-confidence structural model (pLDDT global: 93.21) , which can serve as a foundation for further computational analyses.

  • Molecular Dynamics Simulations: To explore:

    • Structural stability at different temperatures (25-90°C)

    • Conformational flexibility and potential binding sites

    • Effects of mutations on protein stability and dynamics

  • Protein-Protein Docking: To predict the interaction interface between AF_1999 and AfAgo, guiding experimental verification.

Functional Prediction:

  • Structure-Based Function Annotation: Using tools like ProFunc, COFACTOR, and COACH to identify potential functional sites based on structural similarity to characterized proteins.

  • Genomic Context Analysis: Examining gene neighborhood and co-expression patterns to infer functional relationships, similar to the operonic arrangement with AfAgo .

  • Evolutionary Coupling Analysis: Identifying co-evolving residues that might be involved in protein-protein interactions or functional sites.

Integration with Experimental Data:

The table below illustrates how computational approaches can be integrated with experimental methods:

Table 4: Integration of Computational and Experimental Approaches

Computational MethodExperimental TechniqueIntegrated Outcome
AlphaFold modeling HDX-MSRefinement of dynamics predictions
Interface predictionMutagenesis and binding assaysValidation of critical interaction residues
Molecular dynamicsCD spectroscopyCorrelation of predicted and observed thermal stability
Virtual screeningBinding assaysIdentification of potential ligands
Evolutionary analysisFunctional assays of conserved residuesValidation of predicted functional sites

The high-confidence AlphaFold model of AF_1999 serves as an excellent starting point, providing a structural framework for designing experiments and generating hypotheses about its function and interactions, particularly in the context of the AfAgo system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.