Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2010 (AF_2010)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2010 (AF_2010) is a protein derived from the archaeon Archaeoglobus fulgidus . A. fulgidus is a hyperthermophilic archaeon, meaning it thrives in extremely hot environments, and it is also a sulfate-metabolizing organism . The genome of A. fulgidus contains 2,436 open reading frames (ORFs), a significant portion of which encode functionally uncharacterized proteins . AF_2010 is one such uncharacterized protein .

Characteristics of Archaeoglobus fulgidus

Archaeoglobus fulgidus is known for its ability to grow under high hydrostatic pressure (HHP) conditions, both heterotrophically and autotrophically . When grown heterotrophically, A. fulgidus exhibits moderate piezophilic behavior, with maximum specific growth rates observed at 20 MPa under specific cultivation conditions. In contrast, autotrophic growth shows piezotolerance between 0.3 to 40 MPa . A. fulgidus is the first sulfur-metabolizing organism whose genome has been fully sequenced . The genome consists of 2,178,400 base pairs .

Multiprotein Complexes in Pyrococcus furiosus

Although not directly related to AF_2010, research on another hyperthermophilic archaeon, Pyrococcus furiosus, provides a context for understanding multiprotein complexes in these organisms . Studies involving non-denaturing fractionation of the native proteome of P. furiosus have identified novel multiprotein complexes . These complexes include proteins with unknown functions and those involved in various metabolic pathways such as amino acid, carbohydrate, and lipid metabolism .

Functional Genomic Analyses

Functional genomic analyses of archaeal groups suggest that conserved and lineage-specific hypothetical proteins may play a central role in the diversification of major archaeal groups . These uncharacterized proteins, like AF_2010, may have significant roles in the adaptation and evolution of archaea .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request, with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
AF_2010; Uncharacterized protein AF_2010
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2010
Target Protein Sequence
MSPDTEEQTGLTIYLYPVIAWIILVTKIESGLRTRTFPVVHGDEGNNLIPLPEDVKNIRI VQSWPDTFLAKATVGAETIDMGIHVSPDVEALKKEAIELIKHKGSLRKAKKDAERESIVS GWFQSKFQSELLNLKKGWRIRGIVRAESPESKTLFNIELIKRVERRKDASHLRSGVFTPY QKSRIEDIPLSQRKIEPGEVDVPIPYDGIYRIAISPNVKTTYFVELFVEKGS
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2010

STRING: 224325.AF2010

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant for protein research?

Archaeoglobus fulgidus is a hyperthermophilic archaeon commonly identified in high-temperature and high-pressure marine environments, particularly in deep-sea hydrothermal vents at depths of 2-5 km below sea level (corresponding to 20-50 MPa pressures) . As a model extremophile, A. fulgidus serves as an excellent subject for studying protein adaptations to extreme conditions. Its proteins, including uncharacterized ones like AF_2010, offer insights into structural modifications that enable biological activity under conditions that would denature most mesophilic proteins. The organism's ability to grow in both heterotrophic and autotrophic conditions up to pressures of 60 MPa makes it valuable for exploring deep biosphere biochemistry and evolutionary adaptations . Studies with recombinant proteins from this organism help elucidate fundamental principles of protein stability and function under extreme conditions.

How does AF_2010 differ from other characterized proteins in Archaeoglobus fulgidus?

While specific literature on AF_2010 is limited in the provided context, comparison with other A. fulgidus proteins (such as AF_1072, another uncharacterized protein from the same organism) reveals common themes in archaeal protein research . Unlike characterized proteins in A. fulgidus involved in known metabolic pathways (such as those in sulfate reduction, lactate oxidation, or CO₂ fixation), uncharacterized proteins like AF_2010 lack assigned biological functions . These proteins often contain domains or structural features that are conserved across archaeal species but differ significantly from bacterial or eukaryotic homologs. Uncharacterized proteins may contain unique temperature and pressure adaptations that contribute to A. fulgidus' extremophilic lifestyle. Understanding the structural and functional differences between AF_2010 and characterized proteins requires comparative genomic analysis, structural prediction, and functional assays under various environmental conditions.

What cultivation conditions are optimal for Archaeoglobus fulgidus prior to protein isolation?

Based on research with A. fulgidus type strain VC-16 (DSM 4304), optimal cultivation conditions depend on the metabolic pathway being utilized. For heterotrophic growth utilizing lactate oxidation coupled to sulfate reduction, A. fulgidus shows maximum growth rates at approximately 20 MPa pressure, with viable growth observed up to 60 MPa . For autotrophic growth via CO₂ fixation coupled to thiosulfate reduction with H₂, growth remains nearly constant from 0.3 to 40 MPa .

The recommended cultivation medium consists of a sea salt base containing:

  • 0.34 g KCl

  • 15.142 g MgSO₄·7H₂O

  • 2.75 g MgCl·6H₂O

  • 0.25 g NH₂Cl

  • 0.056 g CaCl₂·2H₂O

  • 0.0137 g K₂HPO₄·3H₂O

  • 17.8 g NaCl

  • 0.0039 g Fe(NH₄)₂(SO₄)·6H₂O

  • 1 mL Wolfe's trace element solution

  • 0.1 mL Resazurin (0.1% solution)

For heterotrophic growth, the medium should be supplemented with sodium L-lactate (2.1 g/L), yeast extract (1 g/L), and PIPES buffer (3.36 g/L), with pH adjusted to 6.7 . Anoxic conditions must be maintained by flushing with N₂ and adding Na₂S·9H₂O to a final concentration of 1 mM . Growth should be conducted in pressure vessels at appropriate temperatures (typically 80-85°C for optimal growth) to accurately reflect the organism's natural environment.

How can structure-function relationships of AF_2010 be investigated under high pressure conditions?

Investigating structure-function relationships of AF_2010 under high pressure requires specialized methodologies that integrate structural biology with pressure biophysics. Researchers should employ the following approach:

  • Pressure-resistant expression systems: Recombinant production of AF_2010 should utilize expression systems optimized for thermostable proteins, such as modified E. coli strains with chaperone co-expression or cell-free systems supplemented with archaeal ribosomes.

  • High-pressure structural analysis: Techniques such as high-pressure NMR, high-pressure X-ray crystallography, or small-angle X-ray scattering (SAXS) under pressure can provide direct insights into structural changes. Equipment modifications are necessary to maintain both high pressure (up to 60 MPa) and high temperature (80-85°C) simultaneously during data collection .

  • Functional assays under pressure: Custom-designed high-pressure vessels connected to spectrophotometric or fluorometric detection systems should be used to measure enzymatic activity or binding affinity under varying pressure conditions. For AF_2010, comparison of activity profiles across a pressure range of 0.1-60 MPa would reveal pressure-dependent functional changes.

  • Molecular dynamics simulations: Computational approaches using pressure-adapted force fields can predict structural changes and identify key residues involved in pressure adaptation. Simulation parameters should account for both temperature (80-85°C) and pressure (0.1-60 MPa) conditions simultaneously.

  • Comparative analysis: Results should be benchmarked against known pressure-adapted proteins from A. fulgidus to identify common motifs or unique features in AF_2010 .

This multifaceted approach helps elucidate how structural changes in AF_2010 correlate with functional adaptations under pressure conditions relevant to deep-sea environments.

What evidence suggests that AF_2010 plays a role in Archaeoglobus fulgidus pressure adaptation?

While specific information about AF_2010's role in pressure adaptation is not directly provided in the search results, several lines of evidence could be investigated based on what we know about A. fulgidus biology:

  • Differential expression analysis: Comparing transcriptomic or proteomic profiles of A. fulgidus grown at atmospheric pressure versus high pressure (20-60 MPa) could reveal whether AF_2010 is upregulated under high-pressure conditions . Such upregulation would strongly suggest involvement in pressure adaptation.

  • Comparative genomics: Analysis of AF_2010 conservation across Archaeoglobus species from different depth habitats can indicate selection pressure on this gene in deep-sea populations. Higher conservation in deep-sea isolates would support a pressure adaptation role.

  • Structural features: Computational analysis of AF_2010's sequence and predicted structure might reveal hallmarks of pressure adaptation, such as reduced void volumes, increased internal salt bridges, or modified hydrophobic core packing compared to homologs from surface-dwelling archaea.

  • Growth phenotypes: Genetic manipulation (if available for A. fulgidus) to delete or overexpress AF_2010 followed by growth experiments across pressure gradients (0.1-60 MPa) could directly test its contribution to pressure tolerance .

  • Physiological context: Examination of genomic context and potential interaction partners may place AF_2010 in pathways known to be pressure-sensitive, such as membrane homeostasis or protein folding quality control.

The evidence would be considered strongest if multiple approaches converge to indicate a pressure-adaptation role, particularly if differential expression and functional studies align.

What methodological challenges exist in studying the oligomeric state of AF_2010 under varying pressure conditions?

Studying the oligomeric state of archaeal proteins like AF_2010 under pressure presents several methodological challenges that researchers must address:

  • Equipment limitations: Standard analytical ultracentrifugation, size-exclusion chromatography, and native gel electrophoresis equipment is not designed to operate under high pressure. Specialized high-pressure cells for analytical techniques must be developed or adapted from existing designs used in high-pressure biophysics.

  • Temporal resolution: Pressure-induced changes in oligomerization may occur rapidly, requiring techniques with sufficient temporal resolution to capture transient intermediates. Time-resolved small-angle X-ray scattering (TR-SAXS) with pressure jump capability offers promising solutions but requires specialized synchrotron beamline setups.

  • Combined pressure-temperature effects: Since A. fulgidus proteins function optimally at high temperatures (80-85°C), oligomerization studies must simultaneously control both pressure (up to 60 MPa) and temperature variables . This compounds equipment design challenges and may introduce thermal expansion artifacts that must be distinguished from genuine biomolecular changes.

  • Reference standards: Calibration of molecular weight or hydrodynamic radius measurements under pressure requires well-characterized pressure-stable reference proteins, which are not widely available for the extreme conditions where AF_2010 functions naturally.

  • Data interpretation complexity: Pressure effects on buffer components, solvent properties, and protein-solvent interactions can complicate the interpretation of raw data from techniques like dynamic light scattering or analytical ultracentrifugation under pressure.

Solutions include developing specialized high-pressure cells compatible with existing analytical instruments, utilizing pressure-resistant fluorescent labels for FRET-based oligomerization assays, and combining experimental approaches with molecular dynamics simulations calibrated for high-pressure conditions.

What is the recommended protocol for recombinant expression of AF_2010?

Based on approaches used for similar archaeal proteins, the recommended protocol for recombinant expression of AF_2010 involves:

  • Vector selection: Choose expression vectors with strong, inducible promoters (T7 or tac) and appropriate tags for purification (His6 or Strep-tag). Include a thermostable selection marker if expression trials will be conducted at elevated temperatures.

  • Host strain optimization:

    • Primary recommendation: E. coli BL21(DE3) derivatives such as Rosetta (for rare codon usage) or C41/C43 (for membrane proteins if AF_2010 has predicted membrane association)

    • Alternative host: E. coli ArcticExpress containing cold-adapted chaperonins for improved folding of hyperthermophilic proteins

    • For challenging cases: Consider Sulfolobus acidocaldarius-based expression systems for native-like folding environments

  • Culture conditions:

    • Initial growth at 37°C to OD600 of 0.6-0.8

    • Temperature reduction to 16-18°C prior to induction

    • Induction with 0.1-0.5 mM IPTG

    • Extended expression period (16-24 hours) at reduced temperature

  • Co-expression strategies:

    • Co-express with archaeal chaperonins (e.g., thermosome subunits)

    • For potential membrane proteins, co-express with SRP pathway components

  • Extraction and purification:

    • Heat treatment (70-80°C for 15-30 minutes) as initial purification step to denature host proteins

    • Affinity chromatography under denaturing conditions if inclusion bodies form

    • Size exclusion chromatography as final polishing step

    • Include reducing agents (1-5 mM DTT or TCEP) throughout purification if cysteine residues are present

The expected yield varies between 2-10 mg/L culture, with purity >95% achievable following the complete purification workflow. Verification of proper folding through circular dichroism spectroscopy at high temperature (80°C) is strongly recommended before functional studies.

How can researchers assess the impact of pressure on AF_2010 structure and function?

Researchers can assess pressure effects on AF_2010 using a multi-technique approach that spans structural, functional, and computational methods:

  • High-pressure spectroscopic techniques:

    • High-pressure circular dichroism (HP-CD) to monitor secondary structure changes

    • High-pressure fluorescence spectroscopy to track tertiary structure alterations through intrinsic tryptophan fluorescence or extrinsic fluorophores

    • HP-FTIR to detect changes in secondary structure elements and hydrogen bonding networks

  • Functional assays under pressure:

    • Design custom pressure chambers with optical windows for continuous spectrophotometric monitoring

    • Implement stopped-flow techniques with pressure cells for kinetic measurements

    • Develop activity assays applicable across the pressure range of 0.1-60 MPa that A. fulgidus naturally experiences

    • Compare activity profiles at atmospheric pressure versus elevated pressures (10, 20, 30, 40, 50, and 60 MPa) to establish pressure dependence

  • Pressure perturbation calorimetry:

    • Measure volumetric changes associated with protein transitions under pressure

    • Determine the volume change of activation (ΔV‡) for any catalytic activities

  • Pressure-jump relaxation techniques:

    • Apply rapid pressure changes while monitoring spectroscopic signals

    • Determine relaxation times for conformational changes under different pressure regimes

  • Computational approaches:

    • Molecular dynamics simulations at varying pressures

    • Normal mode analysis to identify pressure-sensitive regions

    • Comparative modeling with known pressure-adapted proteins

The results should be presented as pressure-dependent stability curves and activity profiles, similar to the growth rate observations for A. fulgidus under varying pressures (peaking at 20 MPa for heterotrophic metabolism) . Correlation of structural perturbations with functional changes will provide the most valuable insights into pressure adaptation mechanisms.

What analytical techniques are most effective for determining the function of uncharacterized proteins like AF_2010?

For uncharacterized archaeal proteins like AF_2010, a strategic combination of computational predictions and experimental validations offers the most effective approach:

Computational Prediction Techniques:

  • Sequence-based function prediction:

    • Position-Specific Iterative BLAST (PSI-BLAST) to identify distant homologs

    • Hidden Markov Model (HMM) profiling against curated functional databases

    • Identification of functional domains through InterProScan

    • Genomic context analysis (gene neighborhood conservation)

  • Structure-based function prediction:

    • AlphaFold2 or RosettaFold for accurate structure prediction

    • Structural comparison with characterized proteins using DALI or VAST

    • Binding site prediction using CASTp or COACH

    • Molecular docking with potential substrates identified from metabolomic data

Experimental Validation Techniques:

  • Interactome analysis:

    • Pull-down assays with recombinant AF_2010 using A. fulgidus lysate

    • Bacterial two-hybrid screening adapted for high-temperature interactions

    • Crosslinking mass spectrometry to identify interaction partners

  • Metabolic profiling:

    • Metabolomic comparison of wild-type versus AF_2010 overexpression strains

    • Isotope-labeled substrate tracing to identify metabolic pathways affected

    • In vitro activity screening against metabolite libraries under archaeal-relevant conditions (high temperature and pressure)

  • Structural biology approaches:

    • Crystallography with substrate analogs or cofactors

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to identify ligand-induced conformational changes

    • NMR-based metabolite screening

  • Genetic approaches (if available):

    • Targeted gene deletion and phenotypic characterization

    • Complementation studies in model organisms

The most effective workflow integrates these approaches sequentially, with computational predictions guiding initial experimental designs, followed by iterative refinement based on experimental outcomes. This strategy has proven particularly valuable for uncharacterized proteins from extremophiles where traditional functional genomics approaches may be limited.

How should researchers interpret structural changes in AF_2010 under different pressure and temperature conditions?

Interpreting structural changes in AF_2010 under varying pressure and temperature conditions requires systematic analysis frameworks that account for the complex interplay between these variables:

  • Baseline establishment:

    • Generate comprehensive structural data (CD spectra, fluorescence profiles, SAXS profiles) at atmospheric pressure across a temperature range (25-90°C)

    • Establish reference points for native structure at optimal growth temperature (80-85°C)

    • Create pressure-temperature phase diagrams showing regions of structural stability

  • Distinguishing pressure from temperature effects:

    ParameterTemperature EffectsPressure EffectsCombined Effects
    Secondary structureGradual unfolding with increasing temperature above optimumCompaction of β-sheets, distortion of α-helicesNon-additive effects require 3D phase diagrams
    Tertiary contactsHydrophobic core disruptionStrengthening of ionic interactions, weakening of hydrophobic interactionsPotential compensatory mechanisms unique to extremophiles
    Volume changesThermal expansionCompression of void volumesNet volume change reflects adaptations to deep-sea environments
    Hydration shellDecreased orderingIncreased orderingCritical for protein-solvent interactions under extreme conditions
  • Functional correlation analysis:

    • Map observed structural changes to functional measurements

    • Identify pressure-sensitive regions that correlate with activity changes

    • Determine if structural changes are adaptive (maintaining function) or disruptive

  • Extremophile-specific interpretations:

    • Compare AF_2010 responses to known pressure-adapted proteins

    • Identify unique features that distinguish archaeal pressure adaptation

    • Consider evolutionary context of A. fulgidus' natural high-pressure environment (20-50 MPa)

  • Statistical analysis recommendations:

    • Apply multivariate analysis techniques to deconvolute pressure and temperature effects

    • Use principal component analysis to identify major structural transitions

    • Develop mathematical models that predict structural states under unmeasured conditions

When interpreting results, researchers should consider that A. fulgidus displays maximum growth rates at 20 MPa for heterotrophic metabolism, suggesting evolutionary adaptation to moderate pressures that may be reflected in AF_2010's structural responses .

What computational approaches can predict functional domains in AF_2010 when experimental data is limited?

When experimental data is limited, researchers can employ a hierarchical computational strategy to predict functional domains in uncharacterized proteins like AF_2010:

  • Sequence-based approaches:

    • Profile-based searches: Employ PSI-BLAST, HHpred, and HMMER against curated databases (Pfam, CDD, SMART) to identify distant homology relationships

    • Motif detection: Use MEME, GLAM2, and InterProScan to identify short functional motifs and signatures

    • Disorder prediction: Apply PONDR, IUPred2A, and MobiDB to identify intrinsically disordered regions that may function in protein-protein interactions

    • Secondary structure prediction: Utilize PSIPRED and JPred to identify structural elements conserved in functional domains

  • Structure-based predictions:

    • Ab initio structure prediction: Generate structural models using AlphaFold2, RosettaFold, or I-TASSER

    • Structural similarity detection: Compare predicted structures against PDB using DALI, TM-align, or VAST to identify structural homologs with known functions

    • Binding site prediction: Apply SiteMap, CASTp, or FTSite to identify potential ligand-binding pockets

    • Electrostatic analysis: Calculate surface electrostatic potentials using APBS to identify potential interaction surfaces

  • Genomic context integration:

    • Gene neighborhood analysis: Examine consistently co-located genes across related archaea

    • Gene fusion detection: Identify fusion events in related organisms that suggest functional relationships

    • Phylogenetic profiling: Compare presence/absence patterns across species to identify proteins with correlated evolutionary histories

  • Systems biology approaches:

    • Protein-protein interaction prediction: Use STRING, STITCH, or PrePPI to identify potential interaction partners

    • Metabolic pathway mapping: Apply PathwayTools or KEGG to place AF_2010 in potential metabolic contexts

    • Co-expression analysis: Analyze transcriptomic data from A. fulgidus under varying conditions to identify genes with correlated expression patterns

  • Machine learning integration:

    • Deep learning function prediction: Apply DeepFRI or DEEPre to predict enzyme commission numbers or Gene Ontology terms

    • Meta-predictors: Use metaservers like COFACTOR or COACH that integrate multiple prediction approaches

The confidence in predictions should be evaluated using statistical measures like precision-recall analysis and cross-validation. Results from multiple methods should be integrated using consensus approaches, with higher confidence assigned to functions predicted by independent methods.

How can isothermal titration calorimetry (ITC) data for AF_2010 be adapted for high-pressure conditions?

Adapting isothermal titration calorimetry (ITC) for high-pressure investigations of AF_2010 binding interactions requires specialized modifications to standard protocols:

  • High-pressure ITC instrumentation:

    • Utilize custom high-pressure ITC cells capable of withstanding pressures up to 60 MPa

    • Implement pressure-resistant injection systems with precise volume control

    • Incorporate piezoelectric pressure sensors for real-time monitoring

    • Ensure thermal stability throughout the pressure range (±0.1°C)

  • Data collection protocol modifications:

    • Perform baseline measurements at each pressure point to account for pressure-dependent heat of dilution

    • Allow extended equilibration time (2-3× standard protocol) between injections

    • Decrease injection volumes (typically 50-70% of standard volumes) to improve signal-to-noise ratio

    • Increase number of injections to compensate for reduced volumes

  • Data analysis considerations:

    • Compressibility effects: Account for volume changes using the following equation:
      ΔG(P) = ΔG(P₀) + ΔV(P - P₀) - 0.5Δκ(P - P₀)²
      where ΔG is Gibbs free energy, ΔV is volume change, Δκ is change in compressibility

    • Pressure-dependent reference states: Calculate binding parameters relative to appropriate reference states at each pressure point

    • Global fitting approaches: Apply global fitting of datasets across multiple pressures to determine pressure-dependence of thermodynamic parameters

  • Result interpretation framework:

    ParameterAtmospheric Pressure AnalysisHigh-Pressure Adaptation
    Binding affinity (Kd)Standard van't Hoff analysisExtended with pressure terms
    Enthalpy changes (ΔH)Direct measurementPressure-corrected values
    Entropy changes (ΔS)Calculated from ΔG and ΔHIncludes pressure-volume work terms
    Volume changes (ΔV)Not availableDerived from pressure dependence of ΔG
    Compressibility changes (Δκ)Not availableDerived from non-linear pressure effects
  • Validation approaches:

    • Cross-validate with other techniques (pressure-dependent fluorescence titration or SPR)

    • Perform measurements at multiple temperatures to generate pressure-temperature phase diagrams

    • Compare with molecular dynamics simulations of binding under pressure

This approach enables quantification of volumetric changes upon binding, which are particularly relevant for proteins adapted to deep-sea environments where A. fulgidus naturally thrives .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.