Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2025 (AF_2025)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_2025

The protein AF_2025 is an uncharacterized protein from the hyperthermophilic archaeon Archaeoglobus fulgidus . A. fulgidus is known for its ability to grow at extremely high temperatures, typically between 60 and 95°C . As an orphan protein, AF_2025 lacks functional annotation, presenting a challenge in understanding its biological role . These proteins are of interest because they may represent novel folds and functions .

Insights from Related Archaeoglobus fulgidus Proteins

While direct information on AF_2025 is limited, studies on other uncharacterized proteins from A. fulgidus provide relevant insights:

  • AF2331: The crystal structure of AF2331 reveals an interdigitated dimer forming a new type of α + β fold . It contains multiple negatively charged surface clusters and is located on the same operon as the basic protein AF2330, suggesting they may form a charge-stabilized complex in vivo .

  • AF1382: The crystal structure of AF1382 shows a winged-helix–turn–helix structure, similar to DNA-binding proteins, suggesting a potential DNA-binding function .

  • AfAgo: The Archaeoglobus fulgidus Argonaute (AfAgo) protein forms a heterodimeric complex with a protein encoded upstream in the same operon. This complex enhances guide RNA-mediated target DNA binding .

Role in DNA Repair

Archaeoglobus fulgidus possesses a family 4 uracil-DNA glycosylase (UDG), known as Afung, which is the primary enzyme responsible for removing uracil from DNA . Studies indicate that Afung employs a β-elimination mechanism for the incision of abasic sites following uracil removal, differing from the hydrolytic mechanism found in other archaea .

Heat Shock Response

The heat shock response in A. fulgidus involves changes in mRNA levels for approximately 10% of its genes . AF1298, a heat shock response protein, binds to the promoter elements of heat shock genes, indicating its role in regulating the heat shock response .

Growth Under Pressure

Archaeoglobus fulgidus can grow under high hydrostatic pressure (HHP) conditions, both heterotrophically and autotrophically . It exhibits piezophilic and piezotolerant behavior, depending on the metabolic strategy .

Relevant Data Tables

Because of the uncharacterized nature of the protein AF_2025, there is no specific data available. Nevertheless, data from related Archaeoglobus fulgidus proteins has been included to present a clearer understanding of the protein.

ProteinMolecular Weight (kDa)StructurePotential Function
AF233111Unusual interdigitated dimer with α + β foldMay form a charge-stabilized complex with AF2330; function unknown
AF138211.14Winged-helix–turn–helixPotential DNA-binding function
AfungN/AN/APrimary uracil-DNA glycosylase, removes uracil from DNA
AfAgoN/AHeterodimeric complexEnhances guide RNA-mediated target DNA binding when in complex with a protein encoded upstream in the same operon

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_2025; Uncharacterized protein AF_2025
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2025
Target Protein Sequence
MVDLDEFEVVLEELVKEVKRRDTIAAVLISTSFVLFGFLALVLLNVIRLEEFMRGIVAIV SLIAIWVLMTAGVYILLSMPLPELPTRIVADSKGVMELMKRNYGGKIYITRQSYRNLPPK VGARMNLEIVDVSDEEVAKYLNHGVELAESIAAAKKLKAKVVSDRKMKVDGVEIIKAEDL F
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2025

STRING: 224325.AF2025

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant AF_2025 protein?

For optimal preservation of recombinant AF_2025 protein activity, storage protocols recommend:

  • Long-term storage at -20°C/-80°C after receipt

  • Aliquoting into smaller volumes to minimize freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

  • Addition of 5-50% glycerol (typically 50% final concentration) when reconstituting for freeze storage

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

Research indicates that repeated freeze-thaw cycles significantly diminish protein integrity and should be avoided. The recommended storage buffer is Tris/PBS-based with 6% trehalose at pH 8.0, which helps maintain protein stability during storage periods .

How should recombinant AF_2025 protein be reconstituted after lyophilization?

The methodological approach for reconstituting lyophilized AF_2025 protein involves:

  • Brief centrifugation of the vial prior to opening to ensure all content is at the bottom

  • Addition of deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL

  • Gentle mixing until completely dissolved (avoid vigorous shaking which can cause protein denaturation)

  • Addition of glycerol to a final concentration of 5-50% (with 50% being standard) for samples intended for long-term storage

  • Aliquoting into volumes appropriate for single-use experiments to avoid repeated freeze-thaw cycles

Following reconstitution, the protein solution should be clear without visible precipitates. If precipitation occurs, gentle warming to room temperature and mild agitation may help resolubilize the protein .

What is known about the source organism Archaeoglobus fulgidus and how does it affect research with AF_2025?

Archaeoglobus fulgidus is a hyperthermophilic archaeon originally isolated from marine hydrothermal vents. Key characteristics relevant to AF_2025 research include:

  • Optimal growth temperature: 83°C (significant for protein stability studies)

  • Strictly anaerobic metabolism (suggesting potential oxygen sensitivity of native proteins)

  • Complete genome sequencing (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)

  • First sulfate-reducing archaeon discovered (unique metabolic pathways)

When working with proteins derived from this organism, researchers should consider the extremophilic nature of A. fulgidus, which may confer unusual stability properties to its proteins. For instance, AF_2025 might exhibit thermostability characteristics that could be advantageous for certain applications. Additionally, the anaerobic lifestyle of A. fulgidus may suggest that some of its proteins function optimally under reducing conditions, which could influence experimental design when studying AF_2025 function .

What are the most effective methods for structural characterization of AF_2025?

For comprehensive structural characterization of AF_2025, a multi-technique approach is recommended:

  • X-ray Crystallography: Given that crystal structures have been determined for other A. fulgidus proteins (as seen with AF_1549 and AF_2059), similar crystallization conditions could be attempted for AF_2025. Based on successful approaches with related proteins, initial screening should include:

    • Temperatures of 18-22°C

    • PEG-based precipitation agents

    • pH ranges of 6.5-8.5

    • Addition of divalent cations (particularly Mg2+ which has been successful with other A. fulgidus proteins)

  • NMR Spectroscopy: For solution-state structural analysis, especially to investigate dynamic regions. This requires:

    • Expression in isotope-enriched media (15N, 13C)

    • Optimization of buffer conditions for stability during long acquisition times

    • Concentration of 0.5-1.0 mM without aggregation

  • Cryo-EM: Particularly useful if AF_2025 forms larger complexes or if crystallization proves challenging.

  • Computational Modeling: Given the availability of structures for other A. fulgidus proteins, homology modeling could provide initial structural insights, especially if combined with molecular dynamics simulations to assess stability of the predicted structures .

What approaches can be used to elucidate the function of the uncharacterized AF_2025 protein?

To systematically investigate the function of AF_2025, a comprehensive experimental workflow should include:

  • Bioinformatic Analysis:

    • Sequence similarity networks to identify distant homologs

    • Structural comparison with known protein families

    • Genomic context analysis to identify functional associations

    • Protein-protein interaction predictions

  • Biochemical Characterization:

    • Substrate screening using metabolite libraries

    • Activity assays for common enzyme classes (kinases, phosphatases, proteases, etc.)

    • Metal binding analysis (ICP-MS) given the presence of metal binding in related A. fulgidus proteins

    • Thermal shift assays in the presence of potential ligands/substrates

  • Interaction Studies:

    • Pull-down assays using tagged AF_2025 from A. fulgidus lysates

    • Yeast two-hybrid screening against A. fulgidus genomic libraries

    • Crosslinking mass spectrometry to identify interaction partners

  • Genetic Approaches:

    • Gene knockout or CRISPR interference in A. fulgidus (if genetic tools available)

    • Heterologous expression in model organisms followed by phenotypic analysis

    • Complementation studies in systems with genetically tractable homologs

Given that AF_2025 contains membrane-associated sequence features (hydrophobic stretches suggesting transmembrane domains), functional studies should include membrane localization experiments and potential roles in membrane processes .

How can researchers effectively express and purify AF_2025 for structural and functional studies?

Optimized expression and purification of AF_2025 for structural and functional studies should follow this methodological workflow:

  • Expression System Selection:

    • E. coli: BL21(DE3) or Rosetta strains have proven successful for AF_2025 expression

    • Alternative systems to consider for eukaryotic studies: Pichia pastoris or insect cells

  • Expression Optimization:

    • Temperature: 16-18°C post-induction (reduces inclusion body formation)

    • Induction: 0.1-0.5 mM IPTG for E. coli systems

    • Duration: Extended expression (18-24h) at lower temperatures

    • Media supplementation: 5% glycerol and osmoprotectants can increase soluble yield

  • Purification Strategy:

    • Primary capture: Ni-NTA affinity chromatography (for His-tagged protein)

    • Secondary purification: Size exclusion chromatography

    • Buffer optimization: Include stabilizing agents (glycerol, trehalose)

  • Protein Quality Assessment:

    • SEC-MALS for oligomeric state determination

    • Thermal shift assays for buffer optimization

    • Dynamic light scattering for aggregation analysis

  • Special Considerations:

    • Given the hyperthermophilic origin, heat treatment (60-70°C) of E. coli lysate can be used as an initial purification step

    • Addition of reducing agents may be necessary based on cysteine content

    • For membrane-associated functions, detergent screening (DDM, LDAO, etc.) should be conducted

Using this approach, yields of 5-10 mg of purified protein per liter of culture can typically be achieved, providing sufficient material for both structural and functional characterization .

What is the predicted structural homology of AF_2025 compared to other characterized proteins?

Structural homology analysis of AF_2025 reveals several interesting relationships:

  • Sequence-Based Predictions:

    • AF_2025 contains motifs suggesting transmembrane helices, particularly in the N-terminal region

    • Secondary structure predictions indicate approximately 60% alpha-helical content

    • No clearly identifiable enzymatic domains based on sequence alone

  • Structural Comparisons:

    • While no crystal structure exists specifically for AF_2025, structural information from related A. fulgidus proteins provides context

    • The protein AF_1549 (PDB: 3BPD) shows characteristic folding patterns common in archaeal proteins

    • AF_2059 (PDB: 2QG3) demonstrates that A. fulgidus proteins often contain novel structural features

  • Domain Architecture Analysis:

    • The transmembrane topology suggests possible functions in membrane transport or signaling

    • C-terminal region shows weak similarity to regulatory domains in other archaeal proteins

The hydrophobic nature and predicted membrane association of AF_2025 presents significant challenges for structural determination by conventional methods, suggesting that specialized approaches such as lipid cubic phase crystallization or detergent screening may be necessary for successful structural elucidation .

What experimental conditions should be considered when investigating potential enzymatic activity of AF_2025?

When designing enzymatic activity assays for AF_2025, the following experimental parameters should be systematically investigated:

  • Temperature Range:

    • Given the hyperthermophilic nature of A. fulgidus, activity should be tested at elevated temperatures (60-85°C)

    • Temperature stability studies should precede activity assays

    • Control experiments at mesophilic temperatures (25-37°C) for comparison

  • pH Optimization:

    • Initial screening across pH 5.0-9.0

    • Buffer selection: phosphate, HEPES, and Tris-based buffers with temperature-compensated pH values

  • Metal Dependency:

    • Screening with common cofactors (Mg2+, Mn2+, Zn2+, Fe2+/3+, Ca2+)

    • EDTA controls to assess metal dependency

    • ICP-MS analysis of purified protein to identify co-purifying metals

  • Reducing Conditions:

    • Given the anaerobic nature of A. fulgidus, activity under reducing conditions (DTT, β-mercaptoethanol, or glutathione) should be evaluated

    • Comparison under aerobic vs. anaerobic conditions

  • Substrate Screening Strategy:

    • Metabolite panels based on A. fulgidus metabolism

    • Common substrates for membrane-associated enzymes

    • Lipid-based substrates given the predicted membrane association

  • Detection Methods:

    • Coupled enzymatic assays

    • Direct product detection by HPLC or LC-MS

    • Thermal shift assays for ligand binding

All assays should include appropriate positive controls (well-characterized enzymes) and negative controls (heat-denatured AF_2025) to validate the experimental design .

What are the key challenges and future directions in AF_2025 research?

Research into the uncharacterized protein AF_2025 from Archaeoglobus fulgidus faces several significant challenges that define future research directions:

  • Functional Annotation Challenges:

    • Limited homology to characterized proteins complicates functional prediction

    • Potential novel enzymatic activities requiring innovative assay development

    • Need for specialized high-temperature biochemical techniques

  • Structural Characterization Hurdles:

    • Predicted membrane association complicating crystallization

    • Requirement for specialized approaches for membrane protein structure determination

    • Challenges in producing sufficient quantities of properly folded protein

  • Future Research Priorities:

    • Development of genetic tools for A. fulgidus to enable in vivo studies

    • Comprehensive interactome mapping to place AF_2025 in biological context

    • Investigation of potential biotechnological applications leveraging thermostability

    • Comparative analysis across extremophiles to understand evolutionary adaptations

  • Collaborative Approaches:

    • Integration of structural biology, biochemistry, and bioinformatics

    • Development of specialized assays for hyperthermophilic proteins

    • Cross-disciplinary studies connecting AF_2025 to broader archaeal biology

The continued investigation of uncharacterized proteins like AF_2025 remains crucial for expanding our understanding of archaeal biology, extremophile adaptations, and potentially discovering novel enzymatic activities with biotechnological applications .

What is the significance of studying uncharacterized proteins like AF_2025 from extremophiles?

The scientific and practical significance of studying uncharacterized proteins from extremophiles such as AF_2025 encompasses multiple dimensions:

  • Evolutionary Insights:

    • Archaea represent a distinct domain of life with unique molecular mechanisms

    • Uncharacterized proteins may represent novel evolutionary solutions to biological challenges

    • Understanding these proteins helps reconstruct the evolution of protein function across domains of life

  • Extremophile Adaptation Mechanisms:

    • Proteins from hyperthermophiles like A. fulgidus reveal molecular adaptations to extreme conditions

    • Structural features conferring thermostability may include increased salt bridges, compact hydrophobic cores, and reduced surface loops

    • These adaptations provide models for protein engineering in biotechnological applications

  • Biotechnological Applications:

    • Thermostable enzymes have significant industrial value for high-temperature processes

    • Novel catalytic activities may enable new biotransformation pathways

    • Structural stability features can be incorporated into protein engineering platforms

  • Fundamental Biochemistry:

    • Uncharacterized proteins often reveal new biochemical principles and mechanisms

    • Discovery of novel enzyme classes expands our understanding of biological catalysis

    • Membrane-associated proteins like AF_2025 may reveal unique adaptations for membrane stability at high temperatures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.