Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2028 (AF_2028)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_2028 (AF_2028) is a protein derived from the archaeon Archaeoglobus fulgidus . It is produced using recombinant DNA technology . AF_2028 is referred to as an uncharacterized protein, which indicates that its specific function has not yet been determined through experimentation .

Table 1: General Information of Recombinant AF_2028

FeatureDescription
SpeciesArchaeoglobus fulgidus
SourceE. coli
TagHis-Tag
Protein LengthFull Length (1-607 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
UniProt IDO28251
SynonymsAF_2028, Uncharacterized protein AF_2028
Gene NameAF_2028

Production and Characteristics

The AF_2028 protein is produced in E. coli cells as a recombinant protein with an N-terminal His tag to facilitate purification . The protein is available as a lyophilized powder . The purity is assessed using SDS-PAGE, with a reported purity level of greater than 90% .

Table 2: Production and Biochemical Details

ParameterDescription
Expression SystemE. coli
TagN-terminal His tag
Molecular WeightReportedly 68.2 kDa based on the number of amino acids.
Purity>85% (SDS-PAGE)
StabilityStable for 6 months in liquid form or 12 months in lyophilized form when stored at -20°C/-80°C

Biological Context and Potential Functions

AF_2028 is derived from Archaeoglobus fulgidus, a hyperthermophilic archaeon known for its ability to reduce sulfate at high temperatures . While AF_2028 is currently annotated as an uncharacterized protein, studies on A. fulgidus have revealed insights into its stress response mechanisms and other cellular processes .

Although the specific function of AF_2028 remains unknown, several lines of evidence suggest potential roles:

  • Involvement in Cellular Pathways: AF_2028 may participate in various cellular pathways and functions, possibly in conjunction with other proteins .

  • Response to Stress: As a product of a hyperthermophilic archaeon, AF_2028 might play a role in the organism's response to heat and other environmental stresses .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we prioritize fulfilling specific tag requests if provided at the time of order.
Synonyms
AF_2028; Uncharacterized protein AF_2028
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-607
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2028
Target Protein Sequence
MLITITSMSAGRLGKIGLVAMIIVLTIITINTSAAPLEVSIEERVNSTINMTDAANGVGT FEYQTDVKGIINVTNNANEDIMDIWVAVDIGLNDGSCSAISTGVQILDSGDVPSKLTNEG GFDTSGADCIIHIPRLGPGESKYVAYDVTETPEIQNGAPFIVEEKYDPAKIPKGGDYTWT VYFNVSLNDTWWSSTGLGGKPSSVTLTVNKNLNTSYDTNWKTLEFADGSSNPKQIISGTL DNNKWLTTTFKVKGNYSTDEAFVSRLVGFGEAYFQFGPINGNISGTKIIDVFAIGNASIG VNKSGPDNSNQWTGNVTIKNTATGLTYIVKSVKVWATDRNYNEINGARYENTTVNVQIGR DESFTSKDLSFQYDKVPIIWGNVTFRLVEDANYGWGVGQDKITDGGNTYIIERIYVIGSY LVKVTKHVESAGNDIYNITLVVENLGGQESPYVYVYDLIPKNFSLTNGDNDWKDPQDRDG DWVNKSSMLAGGPETITNIQLSGYDTGYWWRIRPINASADGDGAYDDYTEIENNQTVVIF YQIQGSEDYKLLDAFIVGIDPILSMNEQTSPKITLVSGAKATSYESVMALATALVGLTAV VGYRRRS
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2028

STRING: 224325.AF2028

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.