Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2048 (AF_2048)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2048 (AF_2048) is a protein derived from the archaeon Archaeoglobus fulgidus . A. fulgidus is a hyperthermophilic microorganism that thrives in extremely hot environments, such as deep-sea vents, oil deposits, and hot springs, with an optimal growth temperature of 83°C . The AF_2048 protein is considered an uncharacterized protein, meaning its specific function within the organism is not yet fully understood .

CharacteristicDescription
SourceArchaeoglobus fulgidus
SynonymsAF_2048, Uncharacterized protein AF_2048
UniProt IDO28231
SpeciesArchaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Expression Region1-307 amino acids
Amino Acid SequenceMAKQMEKKSARLLAFLLALIMIGSVFAYMLSGGSAEHREVVYRLDDFREYVNWTPADPVYVQYYNLSYTSKLGSKDPLASMVTTDLQKLLIPAIFSRQVLEVTRGISQVMIVDFGETVPLYFVDAGMSKIYFAKEDEIKHGNFTLQVRRPGIALVSELSPLVVGYKPLVEKAVDTVEGNYPSFGNKTYSYLSRINGSFAYAFFAYGDVVKQWIRVGNESPADFFFEGYRYNFNNSSYEKVWAMHFEGNYFFGGMNESEKNFEYYKVQNFGDGLSVAVMEDKNFTKVVNARPNILTWQISFNNTQNES

Recombinant Production

The AF_2048 protein is often produced using recombinant DNA technology, where the gene encoding the protein is expressed in a host organism like E. coli or yeast . Recombinant AF_2048 is typically synthesized as a full-length protein with a histidine tag (His-tag) attached to the N-terminus to facilitate purification .

  • Source: E. coli or Yeast

  • Tag: His-tag

  • Protein Length: Full Length (1-307 amino acids) or Partial

  • Purity: Greater than 85% (SDS-PAGE)

  • Form: Lyophilized powder or liquid

Research and Significance

While AF_2048 is currently annotated as an uncharacterized protein, its existence and conservation across species suggest it may have a biological function . Further research is needed to elucidate its specific role in A. fulgidus and its potential applications in biotechnology or other fields. Studies on similar proteins from A. fulgidus have revealed various enzymatic activities and structural features, indicating the diverse functional repertoire of this organism .

  • One study identified and characterized a novel ferric reductase from A. fulgidus, which is involved in iron metabolism .

  • Another study determined the crystal structure of the AF2331 protein from A. fulgidus, revealing an unusual interdigitated dimer with a new type of α + β fold .

  • Research on the Argonaute protein (AfAgo) from A. fulgidus has provided insights into its guide and target strand preferences, broadening the understanding of Argonaute-nucleic acid recognition mechanisms .

  • The hypothetical protein AF2241 from A. fulgidus adopts a cyclophilin-like fold, suggesting a potential role in protein folding or other cellular processes .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: While the tag type is determined during production, if a specific tag type is required, please inform us for preferential development.
Synonyms
AF_2048; Uncharacterized protein AF_2048
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2048
Target Protein Sequence
MAKQMEKKSARLLAFLLALIMIGSVFAYMLSGGSAEHREVVYRLDDFREYVNWTPADPVY VQYYNLSYTSKLGSKDPLASMVTTDLQKLLIPAIFSRQVLEVTRGISQVMIVDFGETVPL YFVDAGMSKIYFAKEDEIKHGNFTLQVRRPGIALVSELSPLVVGYKPLVEKAVDTVEGNY PSFGNKTYSYLSRINGSFAYAFFAYGDVVKQWIRVGNESPADFFFEGYRYNFNNSSYEKV WAMHFEGNYFFGGMNESEKNFEYYKVQNFGDGLSVAVMEDKNFTKVVNARPNILTWQISF NNTQNES
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2048

STRING: 224325.AF2048

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is currently known about the protein AF_2048 from Archaeoglobus fulgidus?

AF_2048 is an uncharacterized protein from the hyperthermophilic archaeon Archaeoglobus fulgidus. According to available data, it is a full-length protein consisting of 307 amino acids that has been detected at the proteomic level but lacks functional annotation . It falls into a category similar to the uPE1 proteins (uncharacterized PE level 1) that are detected experimentally but have unknown functions . The protein is available in recombinant form with a His-tag for research purposes, expressed in E. coli expression systems .

What expression systems are suitable for recombinant production of AF_2048?

E. coli expression systems have proven effective for the recombinant production of AF_2048 and other A. fulgidus proteins. The typical expression system involves:

ComponentRecommended OptionNotes
Expression HostE. coliStandard host for archaeal protein expression
VectorpET21-a or similarAllows for C-terminal His-tagging
Restriction SitesNdeI and XhoICommonly used for insertion into pET vectors
TagC-terminal His6-tagFacilitates purification via IMAC

For optimal expression, strategies used for other A. fulgidus proteins include de novo synthesis of codon-optimized genes and PCR amplification using gene-specific primers . Plasmid construction typically involves cloning the target gene between appropriate restriction sites in expression vectors like pET21-a .

How can I verify the identity and purity of recombinant AF_2048?

Verification of recombinant AF_2048 should employ multiple analytical techniques:

  • SDS-PAGE analysis: To assess protein size and purity.

  • Western blotting: Using anti-His tag antibodies to confirm the presence of the tagged protein.

  • Mass spectrometry: For peptide mass fingerprinting, which creates a unique "mass fingerprint" that can confirm protein identity .

  • Tandem MS (MS-MS): For more detailed characterization of the protein sequence and potential post-translational modifications .

When working with archaeal proteins, special attention should be paid to potential contamination with host cell proteins that may co-purify with the target protein.

What computational methods are most effective for predicting the function of AF_2048?

Multiple computational approaches should be integrated for reliable functional prediction of AF_2048:

Method CategorySpecific ApproachesApplicability to AF_2048
Sequence-basedHomology searches, Conserved domain analysis, Motif identificationPrimary screening for functional hints
Structure-basedAlphaFold prediction, Fold recognition, Binding site analysisMay reveal functional architecture similar to characterized archaeal proteins
Network-basedProtein-protein interaction prediction, Co-expression analysisCan place AF_2048 in biological context
IntegrativeGO-term annotation transfer, Consensus functional predictionCombines multiple evidence types for higher confidence

A comprehensive approach to annotation helps discover new structures and functions, potentially classifying AF_2048 into specific protein pathways . Studies on other archaeal proteins indicate that re-analysis of existing interactomic data can yield novel insights into protein function .

What experimental design would be optimal for determining the enzymatic activity of AF_2048?

Based on established experimental design principles, a systematic approach would include:

  • Variables definition:

    • Independent variable: Potential substrates, cofactors, or conditions

    • Dependent variable: Measurable enzymatic activity

    • Control variables: Temperature, pH, buffer composition

  • Experimental treatments:

    • Comparison of wild-type AF_2048 vs. engineered variants

    • Testing various potential substrates based on computational predictions

    • Including positive controls with known enzymatic activities

  • Group assignment strategies:

    • Between-subjects design: Different samples for different conditions

    • Within-subjects design: Same sample under varied conditions8

  • Measurement plan:

    • Activity assays appropriate to predicted function

    • Product identification via chromatography and mass spectrometry

    • Kinetic parameter determination

How can structural analysis inform functional predictions for AF_2048?

Structural analysis provides critical insights into potential AF_2048 functions:

  • Structural model generation:

    • Tools like AlphaFold can generate predicted structures with confidence scores (pLDDT)

    • Regions with higher pLDDT scores (>70) would be more reliable for functional analysis

  • Structural comparison:

    • Analysis of structural similarities with characterized proteins

    • Identification of conserved folds that may indicate function

  • Active site prediction:

    • Identification of potential binding pockets or catalytic residues

    • Analysis of surface electrostatic properties and conservation

The example of Archaeoglobus fulgidus ferritin (AfFtn) demonstrates how unique structural features (tetrahedral symmetry, large pores) can relate to function, and how specific mutations (K150A/R151A) can dramatically alter protein properties . Similar structure-function relationships might exist for AF_2048.

What strategies can be employed to study protein-protein interactions involving AF_2048?

To investigate potential interacting partners of AF_2048:

  • Affinity-based approaches:

    • His-tag pull-down assays using recombinant AF_2048 as bait

    • Co-immunoprecipitation with antibodies against AF_2048

    • Affinity purification coupled with mass spectrometry (AP-MS)

  • Biophysical methods:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis for interaction screening

  • Computational prediction:

    • Analysis of potential interaction interfaces based on structural models

    • Prediction of binding partners based on structural complementarity

    • Co-evolution analysis to identify potential interacting partners

Data from protein-protein interaction studies can be integrated with other functional data to build interactome networks, similar to the BioPlex project approach for human proteins . This can place AF_2048 in a functional context within cellular networks.

What functional annotation workflow is recommended for AF_2048?

A comprehensive functional annotation workflow should integrate computational prediction with experimental validation:

  • Initial computational analysis:

    • Sequence similarity searches using BLAST against characterized proteins

    • Domain and motif identification using InterPro, Pfam

    • Structural prediction using AlphaFold and fold recognition

  • Experimental validation:

    • Expression and purification of recombinant protein

    • Biochemical assays based on computational predictions

    • Structural studies (if possible)

    • Protein-protein interaction analysis

  • Integrative analysis:

    • Combining multiple lines of evidence for consensus prediction

    • Network-based analysis to place AF_2048 in biological context

    • GO-term annotation based on experimental evidence

This systematic approach maximizes the chances of successfully annotating AF_2048, helping to reduce the number of uncharacterized proteins remaining in archaeal proteomes, similar to the neXt-CP50 challenge for human proteins .

How can site-directed mutagenesis be used to investigate AF_2048 function?

Site-directed mutagenesis is a powerful approach for functional investigation:

  • Target selection:

    • Conserved residues identified through multiple sequence alignments

    • Predicted functional residues based on structural models

    • Residues in potential binding sites or catalytic regions

  • Mutagenesis strategy:

    • PCR-based site-directed mutagenesis using duplex primers

    • Creation of single and multiple mutants to assess cooperativity

    • Alanine scanning of predicted functional regions

  • Functional assessment:

    • Comparison of wild-type and mutant protein activities

    • Structural analysis to determine effects on protein folding

    • Binding studies to assess effects on interaction potential

The approach used for Archaeoglobus fulgidus ferritin (AfFtn), where the K150A/R151A double mutation altered symmetry and functional properties, demonstrates how targeted mutations can reveal structure-function relationships in archaeal proteins .

What mass spectrometry approaches are optimal for characterizing AF_2048?

Mass spectrometry offers several approaches for comprehensive characterization:

For uncharacterized proteins like AF_2048, peptide mass fingerprinting has been shown to be particularly effective when matching as few as three to four peptides is enough to identify the protein .

How do experimental approaches for AF_2048 differ from those used for eukaryotic uncharacterized proteins?

Key differences in experimental approaches include:

  • Expression conditions:

    • Higher temperatures often required for proper folding of archaeal proteins

    • Special consideration for hyperthermophilic origin of A. fulgidus

    • Potential need for archaeal-specific chaperones

  • Structural analysis:

    • Greater focus on thermostability and unique archaeal folds

    • Consideration of extremophile adaptations in structure-function relationships

    • Comparison with both bacterial and eukaryotic homologs

  • Functional prediction:

    • Analysis of archaeal-specific metabolic pathways

    • Consideration of unique cellular processes in archaea

    • Recognition that some archaeal proteins may have no direct eukaryotic homologs

Working with archaeal proteins requires consideration of their evolutionary distance from both bacteria and eukaryotes, and recognition that they may possess unique structural and functional properties not seen in other domains of life.

What challenges are specific to crystallizing AF_2048 for structural determination?

Crystallization of archaeal uncharacterized proteins presents specific challenges:

  • Protein production issues:

    • Ensuring proper folding in heterologous expression systems

    • Optimizing solubility of hyperthermophilic proteins at lower temperatures

    • Purifying sufficient quantities for crystallization trials

  • Crystallization conditions:

    • Testing thermostability-enhancing additives

    • Screening wider temperature ranges than typical proteins

    • Considering archaeal-specific buffer conditions

  • Structure determination considerations:

    • Potential for unique folds requiring careful phasing strategies

    • Use of methods like selenomethionine substitution for phasing

    • Application of specialized software for archaeal protein structure refinement

The crystal structure determination of other A. fulgidus uncharacterized proteins has employed techniques such as selenomethionine incorporation, MAR345 for data collection, and software like MOLREP for phasing and CNS for refinement .

How does AF_2048 compare to other uncharacterized proteins from Archaeoglobus fulgidus?

Comparative analysis within the A. fulgidus proteome can provide functional context:

  • Sequence-based comparison:

    • Identification of paralogous proteins within A. fulgidus

    • Analysis of gene neighborhood and potential operonic structure

    • Correlation with expression data if available

  • Structural comparison:

    • Analysis of structural similarity to other A. fulgidus proteins

    • Identification of shared structural features among uncharacterized proteins

    • Comparison with characterized proteins like AfFtn

  • Evolutionary analysis:

    • Conservation patterns across Archaeoglobus species

    • Presence/absence patterns in related archaea

    • Identification of lineage-specific features

Other uncharacterized A. fulgidus proteins, such as AF_1549, have been structurally characterized and deposited in the PDB (e.g., 3BPD) , providing valuable reference data for comparative analysis of AF_2048.

How can "People Also Ask" data be leveraged in research on uncharacterized proteins?

"People Also Ask" data from search engines can be a valuable resource for research planning:

  • Identifying research gaps:

    • Questions frequently asked but lacking clear answers

    • Emerging trends in research on uncharacterized proteins

    • Common methodological challenges 7

  • Experimental design guidance:

    • Identification of relevant variables to consider

    • Common control conditions used in similar studies

    • Typical approaches to specific challenges7

  • Knowledge synthesis:

    • Integration of information from diverse sources

    • Building a more comprehensive understanding of the research landscape

    • Identifying connections between seemingly disparate research areas

Tools that mine "People Also Ask" data can help researchers discover questions and research directions they might not have considered, potentially revealing new approaches to characterizing proteins like AF_2048 7.

What emerging technologies show promise for characterizing proteins like AF_2048?

Several cutting-edge technologies hold potential for uncharacterized protein research:

  • Advanced computational approaches:

    • Deep learning models beyond AlphaFold for function prediction

    • Quantum computing applications for protein-ligand interactions

    • Improved molecular dynamics simulations for conformational analysis

  • Novel experimental methods:

    • Cryo-electron microscopy for structural determination without crystallization

    • Single-molecule techniques for studying protein dynamics

    • Microfluidic approaches for high-throughput functional screening

  • Integrative methods:

    • Multi-omics data integration platforms

    • Systems biology approaches to place proteins in functional networks

    • Synthetic biology tools to test predicted functions in vivo

These emerging technologies may help overcome current limitations in characterizing uncharacterized proteins like AF_2048, potentially accelerating the rate of functional annotation.

How might research on AF_2048 contribute to understanding archaeal biology?

Research on AF_2048 has broader implications for archaeal biology:

  • Fundamental insights:

    • Potential discovery of novel protein families or functions

    • Better understanding of archaeal-specific cellular processes

    • Insights into protein adaptation to extreme environments

  • Evolutionary perspectives:

    • Understanding archaeal protein evolution

    • Potential identification of archaeal-specific structural features

    • Insights into the evolution of protein functions across domains of life

  • Biotechnological applications:

    • Potential identification of novel enzymes with useful properties

    • Insights into protein stability under extreme conditions

    • New tools for synthetic biology and protein engineering

The characterization of AF_2048 would contribute to reducing the number of uncharacterized proteins in archaeal proteomes, similar to efforts like the neXt-CP50 challenge for human proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.